Gene/Proteome Database (LMPD)

LMPD ID
LMP007135
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
glycylpeptide N-tetradecanoyltransferase NMT1
Gene Symbol
Synonyms
CDC72
Chromosome
XII
EC Number
2.3.1.97

Proteins

glycylpeptide N-tetradecanoyltransferase NMT1
Refseq ID NP_013296
Protein GI 6323224
UniProt ID P14743
mRNA ID NM_001182082
Length 455
MSEEDKAKKLENLLKLLQLNNDDTSKFTQEQKKAMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML

Gene Information

Entrez Gene ID
Gene Name
glycylpeptide N-tetradecanoyltransferase NMT1
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:SGD C cytosol
GO:0004379 IMP:SGD F glycylpeptide N-tetradecanoyltransferase activity
GO:0018008 TAS:SGD P N-terminal peptidyl-glycine N-myristoylation
GO:0001302 IMP:SGD P replicative cell aging

REACTOME Pathway Links

REACTOME Pathway ID Description
5618026 Disease
5618651 Diseases associated with visual transduction
5618659 Inactivation, recovery and regulation of the phototransduction cascade
5618100 Signal Transduction
5618660 The phototransduction cascade
5618653 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR016181 Acyl-CoA N-acyltransferase
IPR000903 Myristoyl-CoA:protein N-myristoyltransferase
IPR022677 Myristoyl-CoA:protein N-myristoyltransferase, C-terminal
IPR022676 Myristoyl-CoA:protein N-myristoyltransferase, N-terminal
IPR022678 Myristoyl-CoA:protein N-myristoyltransferase, conserved site

UniProt Annotations

Entry Information

Gene Name
glycylpeptide N-tetradecanoyltransferase NMT1
Protein Entry
NMT_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=1.4 uM for myristoyl-CoA {ECO:0000269|PubMed:11478885, ECO:0000269|PubMed:3106975}; pH dependence: Optimum pH is 7.5-8.0. {ECO:0000269|PubMed:11478885, ECO:0000269|PubMed:3106975};
Biophysicochemical Properties Kinetic parameters: KM=1.4 uM for myristoyl-CoA {ECO:0000269|PubMed:11478885, ECO:0000269|PubMed:3106975}; pH dependence: Optimum pH is 7.5-8.0. {ECO:0000269|PubMed:11478885, ECO:0000269|PubMed:3106975};
Catalytic Activity Tetradecanoyl-CoA + glycylpeptide = CoA + N- tetradecanoylglycylpeptide.
Enzyme Regulation Inhibited by diethylpyrocarbonate. Competitively inhibited by S-(2-oxo)pentadecyl-CoA, a non hydrolysable myristoyl-CoA analog, and by SC-58272, a peptidomimetic derived from the N-terminal sequence of a natural substrate.
Function Adds a myristoyl group to the N-terminal glycine residue of certain cellular proteins. Substrate specificity requires an N- terminal glycine in the nascent polypeptide substrates. Uncharged amino acids are preferred at position 2 while neutral residues are favored at positions 3 and 4. Ser is present at position 5 in almost all known N-myristoyl proteins and Lys is commonly encountered at postion 6.
Miscellaneous Has an ordered Bi-Bi kinetic mechanism, with myristoyl-CoA binding taking place prior to peptide binding and CoA release occurring before acylated peptide release. Cooperative interactions between the acyl-CoA and peptide binding sites of NMT contribute to its extraordinary chain-length specificity.
Ptm The N-terminus is blocked.
Similarity Belongs to the NMT family
Similarity Belongs to the NMT family. {ECO:0000305}.
Subcellular Location Cytoplasm .
Subcellular Location Cytoplasm {ECO:0000269|PubMed:14562095}.
Subunit Monomer. {ECO:0000269|PubMed:11371195, ECO:0000269|PubMed:9846880}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007135 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6323224 RefSeq NP_013296 455 glycylpeptide N-tetradecanoyltransferase NMT1

Identical Sequences to LMP007135 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007135 proteins

Reference Database Accession Length Protein Name