Gene/Proteome Database (LMPD)
Proteins
| Gpi19p | |
|---|---|
| Refseq ID | NP_010725 |
| Protein GI | 398366595 |
| UniProt ID | Q04082 |
| mRNA ID | NM_001180745 |
| Length | 140 |
| MYTKEYYWFSQYMIITSTLVLTIIWSILPSSLGEAAPKQFINTLLDIFPQRRWIITLESIMLMGMLCTYIGLLMYNEDTLTPPLDSLSTVTDAGGQLVIEDDPDVFVKKWAFKETSGIYDLSLMDACQLLYLYDNDHTST | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000506 | IPI:SGD | C | glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex |
| GO:0030176 | IDA:SGD | C | integral component of endoplasmic reticulum membrane |
| GO:0017176 | IEA:UniProtKB-EC | F | phosphatidylinositol N-acetylglucosaminyltransferase activity |
| GO:0006506 | IMP:SGD | P | GPI anchor biosynthetic process |
| GO:0071555 | IEA:UniProtKB-KW | P | cell wall organization |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR013717 | PIG-P |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | UDP-N-acetyl-D-glucosamine + 1-phosphatidyl- 1D-myo-inositol = UDP + 6-(N-acetyl-alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol. |
| Function | Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. Involved in cell wall biosynthesis |
| Function | Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. Involved in cell wall biosynthesis. {ECO:0000269|PubMed:16278447}. |
| Miscellaneous | Present with 752 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 752 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
| Similarity | Belongs to the GPI19 family |
| Similarity | Belongs to the GPI19 family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein . |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Subunit | Component of the phosphatidylinositol N- acetylglucosaminyltransferase complex composed of at least GPI1, GPI2, GPI3, GPI15, GPI19 and ERI1 |
| Subunit | Component of the phosphatidylinositol N- acetylglucosaminyltransferase complex composed of at least GPI1, GPI2, GPI3, GPI15, GPI19 and ERI1. {ECO:0000269|PubMed:16278447}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007134 (as displayed in Record Overview)
Identical Sequences to LMP007134 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007134 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|