Gene/Proteome Database (LMPD)

LMPD ID
LMP007093
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
putative monooxygenase CAT5
Gene Symbol
Synonyms
COQ7
Alternate Names
putative monooxygenase CAT5
Chromosome
XV

Proteins

putative monooxygenase CAT5
Refseq ID NP_014768
Protein GI 37362696
UniProt ID P41735
mRNA ID NM_001183544
Length 233
RefSeq Status PROVISIONAL
MLSRVSVFKPASRGFSVLSSLKITEHTSAKHTEKPEHAPKCQNLSDAQAAFLDRVIRVDQAGELGADYIYAGQYFVLAHRYPHLKPVLKHIWDQEIHHHNTFNNLQLKRRVRPSLLTPLWKAGAFAMGAGTALISPEAAMACTEAVETVIGGHYNGQLRNLANQFNLERTDGTKGPSEEIKSLTSTIQQFRDDELEHLDTAIKHDSYMAVPYTVITEGIKTICRVAIWSAERI

Gene Information

Entrez Gene ID
Gene Name
putative monooxygenase CAT5
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005743 IDA:SGD C mitochondrial inner membrane
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0004497 ISS:SGD F monooxygenase activity
GO:0016709 TAS:Reactome F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0006094 IEA:UniProtKB-KW P gluconeogenesis
GO:0006744 IMP:SGD P ubiquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
sce00130 Ubiquinone and other terpenoid-quinone biosynthesis
sce_M00128 Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate => ubiquinone

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-7230 ubiquinol-6 biosynthesis from 4-aminobenzoate

Domain Information

InterPro Annotations

Accession Description
IPR009078 Ferritin-like superfamily
IPR011566 Ubiquinone biosynthesis protein Coq7

UniProt Annotations

Entry Information

Gene Name
putative monooxygenase CAT5
Protein Entry
CAT5_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; Note=Binds 2 iron ions per subunit. {ECO:0000250};
Function Central metabolic regulator required for the derepression of PCK1, and thereby gluconeogenesis. Necessary for transcriptional activation of the CAT8 gene. Also involved in the control of expression of other enzymes of gluconeogenesis and those of respiration and the glyoxylate cycle. Also involved in one or more monooxygenase steps of ubiquinone biosynthesis. {ECO:0000269|PubMed:8557031, ECO:0000269|PubMed:8621692, ECO:0000269|PubMed:9452453}.
Pathway Cofactor biosynthesis; ubiquinone biosynthesis.
Similarity Belongs to the COQ7 family. {ECO:0000305}.
Subcellular Location Mitochondrion inner membrane {ECO:0000269|PubMed:14576278, ECO:0000269|PubMed:9452453}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007093 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
37362696 RefSeq NP_014768 233 putative monooxygenase CAT5

Identical Sequences to LMP007093 proteins

Reference Database Accession Length Protein Name
GI:37362696 GenBank EDN63987.1 233 catabolite repression protein [Saccharomyces cerevisiae YJM789]
GI:37362696 GenBank EIW07556.1 233 Cat5p [Saccharomyces cerevisiae CEN.PK113-7D]
GI:37362696 SwissProt P41735.2 233 RecName: Full=Catabolite repression protein CAT5; AltName: Full=Coenzyme Q biosynthesis protein 7; AltName: Full=Ubiquinone biosynthesis protein COQ7 [Saccharomyces cerevisiae S288c]
GI:37362696 Third Party Genbank DAA10899.1 233 TPA: putative monooxygenase CAT5 [Saccharomyces cerevisiae S288c]

Related Sequences to LMP007093 proteins

Reference Database Accession Length Protein Name
GI:37362696 EMBL CAA58105.1 272 CAT5 [Saccharomyces cerevisiae]
GI:37362696 EMBL CAA62119.1 272 ORF O3284 [Saccharomyces cerevisiae]
GI:37362696 EMBL CAA64044.1 272 YOR3284c [Saccharomyces cerevisiae]
GI:37362696 EMBL CAA99324.1 272 CAT5 [Saccharomyces cerevisiae]
GI:37362696 GenBank AAB36435.1 272 COQ7 [Saccharomyces cerevisiae]
GI:37362696 GenBank EWG88858.1 233 Cat5p [Saccharomyces cerevisiae P301]