Gene/Proteome Database (LMPD)

LMPD ID
LMP007073
Gene ID
856870
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
type 1 serine/threonine-protein phosphatase catalytic subunit GLC7
Gene Symbol
GLC7
Synonyms
CID1; DIS2
Chromosome
V
EC Number
3.1.3.16;

Proteins

type 1 serine/threonine-protein phosphatase catalytic subunit GLC7
Refseq ID NP_011059
Protein GI 398364803
UniProt ID P32598
mRNA ID NM_001179023
Length 312
MDSQPVDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQKSLPRQAGGRKKK

Gene Information

Entrez Gene ID
856870
Gene Name
type 1 serine/threonine-protein phosphatase catalytic subunit GLC7
Gene Symbol
GLC7
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005935 IDA:SGD C cellular bud neck
GO:0000778 IDA:SGD C condensed nuclear chromosome kinetochore
GO:0005847 IDA:SGD C mRNA cleavage and polyadenylation specificity factor complex
GO:0001400 IDA:SGD C mating projection base
GO:0005730 IDA:SGD C nucleolus
GO:0005634 IDA:SGD C nucleus
GO:0000164 IDA:SGD C protein phosphatase type 1 complex
GO:0005816 IDA:SGD C spindle pole body
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0004722 IDA:SGD F protein serine/threonine phosphatase activity
GO:0000077 IMP:SGD P DNA damage checkpoint
GO:0000076 IMP:SGD P DNA replication checkpoint
GO:0030437 IMP:SGD P ascospore formation
GO:0007114 IMP:SGD P cell budding
GO:0006873 IMP:SGD P cellular ion homeostasis
GO:0007059 IMP:SGD P chromosome segregation
GO:0070940 IDA:SGD P dephosphorylation of RNA polymerase II C-terminal domain
GO:0005977 IMP:SGD P glycogen metabolic process
GO:0016576 IDA:SGD P histone dephosphorylation
GO:0006397 IEA:UniProtKB-KW P mRNA processing
GO:0007126 IPI:SGD P meiotic nuclear division
GO:0007067 IEA:UniProtKB-KW P mitotic nuclear division
GO:0007094 IMP:SGD P mitotic spindle assembly checkpoint
GO:0035307 IMP:SGD P positive regulation of protein dephosphorylation
GO:0006470 IDA:SGD P protein dephosphorylation
GO:0034501 IMP:SGD P protein localization to kinetochore
GO:0006364 IMP:SGD P rRNA processing
GO:0006109 IGI:SGD P regulation of carbohydrate metabolic process
GO:0051726 IMP:SGD P regulation of cell cycle
GO:0000903 IGI:SGD P regulation of cell shape during vegetative growth phase
GO:0007346 IMP:SGD P regulation of mitotic cell cycle
GO:0031297 IMP:SGD P replication fork processing
GO:0009408 IMP:SGD P response to heat
GO:0030847 IPI:SGD P termination of RNA polymerase II transcription, exosome-dependent
GO:0030846 IPI:SGD P termination of RNA polymerase II transcription, poly(A)-coupled
GO:0061587 IMP:SGD P transfer RNA gene-mediated silencing

KEGG Pathway Links

KEGG Pathway ID Description
ko04113 Meiosis - yeast
sce04113 Meiosis - yeast
ko03015 mRNA surveillance pathway
sce03015 mRNA surveillance pathway

Domain Information

InterPro Annotations

Accession Description
IPR004843 Calcineurin-like phosphoesterase domain, apaH type
IPR029052 Metallo-dependent phosphatase-like
IPR006186 Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase

UniProt Annotations

Entry Information

Gene Name
type 1 serine/threonine-protein phosphatase catalytic subunit GLC7
Protein Entry
PP12_YEAST
UniProt ID
P32598
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity [a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence= ; Note=Binds 2 manganese ions per subunit. ;
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250}; Note=Binds 2 manganese ions per subunit. {ECO:0000250};
Function Component of the cleavage and polyadenylation factor (CPF) complex, which plays a key role in polyadenylation-dependent pre-mRNA 3'-end formation and cooperates with cleavage factors including the CFIA complex and NAB4/CFIB. Component of the APT complex, which may be involved in polyadenylation-independent transcript 3'-end formation.
Function Involved in control of glycogen metabolism, meiosis, translation, chromosome segregation, cell polarity and G2/M cell cycle progression. PP1 may act in opposition to the IPL1 protein kinase in regulating chromosome segregation by dephosphorylating H3S10ph. The BUD14-GLC7 complex is necessary to regulate microtubule dynamics at the cortex and may function as a specific activator of the dynein complex.
Interaction P53858:BNI4; NbExp=4; IntAct=EBI-13715, EBI-3704; P27637:BUD14; NbExp=7; IntAct=EBI-13715, EBI-20747; P39732:GIP4; NbExp=4; IntAct=EBI-13715, EBI-20636; P41818:GLC8; NbExp=3; IntAct=EBI-13715, EBI-7629; P43638:MHP1; NbExp=3; IntAct=EBI-13715, EBI-10880; P42073:REF2; NbExp=7; IntAct=EBI-13715, EBI-14915; P34758:SCD5; NbExp=3; IntAct=EBI-13715, EBI-16685; P36047:SDS22; NbExp=6; IntAct=EBI-13715, EBI-16783; P50278:SOL1; NbExp=3; IntAct=EBI-13715, EBI-17675; P43587:YPI1; NbExp=4; IntAct=EBI-13715, EBI-22913;
Miscellaneous Present with 14600 molecules/cell in log phase SD medium
Miscellaneous Present with 14600 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Belongs to the PPP phosphatase family. PP-1 subfamily
Similarity Belongs to the PPP phosphatase family. PP-1 subfamily. {ECO:0000305}.
Subcellular Location Cytoplasm . Nucleus .
Subcellular Location Cytoplasm {ECO:0000269|PubMed:12819204}. Nucleus {ECO:0000269|PubMed:12819204}.
Subunit Probably complexed with regulatory or targeting subunits. Interacts with BUD14. Component of the cleavage and polyadenylation factor (CPF) complex, which is composed of PTI1, SYC1, SSU72, GLC7, MPE1, REF2, PFS2, PTA1, YSH1/BRR5, SWD2, CFT2/YDH1, YTH1, CFT1/YHH1, FIP1 and PAP1. Component of the APT complex, which is a subcomplex of CPF, and is composed of PTI1, SYC1, SSU72, GLC7, REF2, PTA1 and SWD2. {ECO:0000269|PubMed:12477789, ECO:0000269|PubMed:12819204, ECO:0000269|PubMed:16107882}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007073 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
398364803 RefSeq NP_011059 312 type 1 serine/threonine-protein phosphatase catalytic subunit GLC7

Identical Sequences to LMP007073 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007073 proteins

Reference Database Accession Length Protein Name