Gene/Proteome Database (LMPD)

LMPD ID
LMP007035
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
aldo-keto reductase superfamily protein
Gene Symbol
Synonyms
-
Alternate Names
aldo-keto reductase superfamily protein
Chromosome
X
EC Number
1.-.-.-

Proteins

aldo-keto reductase superfamily protein
Refseq ID NP_012630
Protein GI 6322556
UniProt ID P47137
mRNA ID NM_001181754
Length 282
RefSeq Status PROVISIONAL
MVPKFYKLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPLEGSKLRLETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPLCHGYKMTNPDLLKVCKEVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFLDHPDAYEPTDWECTDAP

Gene Information

Entrez Gene ID
Gene Name
aldo-keto reductase superfamily protein
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0004032 IDA:SGD F alditol:NADP+ 1-oxidoreductase activity
GO:0004033 IDA:SGD F aldo-keto reductase (NADP) activity
GO:0042843 IMP:SGD P D-xylose catabolic process
GO:0019568 IDA:SGD P arabinose catabolic process
GO:0034599 IGI:SGD P cellular response to oxidative stress

Domain Information

InterPro Annotations

Accession Description
IPR001395 Aldo/keto reductase
IPR020471 Aldo/keto reductase subgroup
IPR018170 Aldo/keto reductase, conserved site
IPR023210 NADP-dependent oxidoreductase domain

UniProt Annotations

Entry Information

Gene Name
aldo-keto reductase superfamily protein
Protein Entry
YJ66_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Interaction P33203:PRP40; NbExp=2; IntAct=EBI-25572, EBI-701; P39940:RSP5; NbExp=3; IntAct=EBI-25572, EBI-16219;
Miscellaneous Present with 6960 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Belongs to the aldo/keto reductase family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007035 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6322556 RefSeq NP_012630 282 aldo-keto reductase superfamily protein

Identical Sequences to LMP007035 proteins

Reference Database Accession Length Protein Name
GI:6322556 GenBank EGA86118.1 282 YJR096W-like protein [Saccharomyces cerevisiae VL3]
GI:6322556 GenBank EHN06266.1 282 YJR096W-like protein [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:6322556 GenBank EWG85188.1 282 hypothetical protein R008_J12026 [Saccharomyces cerevisiae R008]
GI:6322556 GenBank EWG88020.1 282 hypothetical protein P301_J30536 [Saccharomyces cerevisiae P301]
GI:6322556 GenBank EWG95187.1 282 hypothetical protein R103_J31321 [Saccharomyces cerevisiae R103]
GI:6322556 GenBank EWH17640.1 282 hypothetical protein P283_J20661 [Saccharomyces cerevisiae P283]

Related Sequences to LMP007035 proteins

Reference Database Accession Length Protein Name
GI:6322556 DBBJ GAA24442.1 282 K7_Yjr096wp [Saccharomyces cerevisiae Kyokai no. 7]
GI:6322556 GenBank EDN63412.1 282 aldo-keto reductase [Saccharomyces cerevisiae YJM789]
GI:6322556 GenBank EHN01626.1 282 YJR096W-like protein [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:6322556 GenBank EIW09619.1 282 hypothetical protein CENPK1137D_1389 [Saccharomyces cerevisiae CEN.PK113-7D]
GI:6322556 GenBank EJT43547.1 282 YJR096W-like protein [Saccharomyces kudriavzevii IFO 1802]
GI:6322556 gnl McCuskerlabDuke 282 hypothetical protein H779_YJM993J00310 [Saccharomyces cerevisiae YJM993]