Gene/Proteome Database (LMPD)
Proteins
| Bet2p | |
|---|---|
| Refseq ID | NP_015502 |
| Protein GI | 6325434 |
| UniProt ID | P20133 |
| mRNA ID | NM_001184273 |
| Length | 325 |
| MSGSLTLLKEKHIRYIESLDTKKHNFEYWLTEHLRLNGIYWGLTALCVLDSPETFVKEEVISFVLSCWDDKYGAFAPFPRHDAHLLTTLSAVQILATYDALDVLGKDRKVRLISFIRGNQLEDGSFQGDRFGEVDTRFVYTALSALSILGELTSEVVDPAVDFVLKCYNFDGGFGLCPNAESHAAQAFTCLGALAIANKLDMLSDDQLEEIGWWLCERQLPEGGLNGRPSKLPDVCYSWWVLSSLAIIGRLDWINYEKLTEFILKCQDEKKGGISDRPENEVDVFHTVFGVAGLSLMGYDNLVPIDPIYCMPKSVTSKFKKYPYK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005968 | IDA:SGD | C | Rab-protein geranylgeranyltransferase complex |
| GO:0017137 | ISS:UniProtKB | F | Rab GTPase binding |
| GO:0004663 | IDA:SGD | F | Rab geranylgeranyltransferase activity |
| GO:0008270 | ISS:UniProtKB | F | zinc ion binding |
| GO:0006888 | IMP:SGD | P | ER to Golgi vesicle-mediated transport |
| GO:0018344 | IDA:SGD | P | protein geranylgeranylation |
| GO:0006612 | IMP:SGD | P | protein targeting to membrane |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate. |
| Cofactor | Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence= ; Note=Binds 1 zinc ion per subunit. ; |
| Cofactor | Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250}; Note=Binds 1 zinc ion per subunit. {ECO:0000250}; |
| Function | Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to proteins having the C-terminal -XCC or -XCXC, where both cysteines may become modified. Acts on YPT1 and SEC4. |
| Interaction | Q00618:BET4; NbExp=3; IntAct=EBI-3559, EBI-3573; |
| Miscellaneous | Present with 1520 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 1520 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the protein prenyltransferase subunit beta family |
| Similarity | Belongs to the protein prenyltransferase subunit beta family. {ECO:0000305}. |
| Similarity | Contains 6 PFTB repeats |
| Similarity | Contains 6 PFTB repeats. {ECO:0000305}. |
| Subunit | Heterodimer of an alpha and a beta subunit. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007024 (as displayed in Record Overview)
Identical Sequences to LMP007024 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007024 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|