LIPID MAPS

LMPD ID

LMP007018

Gene ID

Species

Saccharomyces cerevisiae S288c (Yeast (S288c))

Gene Name

succinate dehydrogenase cytochrome b subunit SDH3

Gene Symbol

SDH3

Synonyms

CYB3; YKL4

Chromosome

XI

succinate dehydrogenase cytochrome b subunit SDH3
Refseq ID	NP_012781
Protein GI	6322708
UniProt ID	P33421
mRNA ID	NM_001179707
Length	198
MSAMMVKLGLNKSALLLKPSAFSRAAALSSSRRLLFNTARTNFLSTSPLKNVASEMNTKAAIAEEQILNKQRAKRPISPHLTIYQPQLTWYLSSLHRISLVLMGLGFYLFTILFGVSGLLGLGLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAIHYGGAIRHLIWDTAKELTLKGVYRTGYALIGFTAVLGTYLLTL

Entrez Gene ID

Gene Name

succinate dehydrogenase cytochrome b subunit SDH3

Gene Symbol

SDH3

Species

Saccharomyces cerevisiae S288c

GO ID	Source	Type	Description
GO:0016021	IEA:UniProtKB-KW	C	integral component of membrane
GO:0042721	IDA:SGD	C	mitochondrial inner membrane protein insertion complex
GO:0005749	IDA:SGD	C	mitochondrial respiratory chain complex II
GO:0009055	IEA:InterPro	F	electron carrier activity
GO:0046872	IEA:UniProtKB-KW	F	metal ion binding
GO:0048038	IEA:UniProtKB-KW	F	quinone binding
GO:0000104	IEA:InterPro	F	succinate dehydrogenase activity
GO:0045333	IMP:SGD	P	cellular respiration
GO:0006121	TAS:SGD	P	mitochondrial electron transport, succinate to ubiquinone
GO:0045039	IMP:SGD	P	protein import into mitochondrial inner membrane
GO:0006099	TAS:SGD	P	tricarboxylic acid cycle

KEGG Pathway ID	Description
sce01110	Biosynthesis of secondary metabolites
ko01200	Carbon metabolism
sce01200	Carbon metabolism
ko00020	Citrate cycle (TCA cycle)
sce00020	Citrate cycle (TCA cycle)
M00009	Citrate cycle (TCA cycle, Krebs cycle)
sce_M00009	Citrate cycle (TCA cycle, Krebs cycle)
M00011	Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sce_M00011	Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sce01100	Metabolic pathways
ko00190	Oxidative phosphorylation
sce00190	Oxidative phosphorylation
M00148	Succinate dehydrogenase (ubiquinone)
sce_M00148	Succinate dehydrogenase (ubiquinone)

BIOCYC Pathway ID	Description
PWY-5690	TCA cycle II (plants and fungi)
TCA-EUK-PWY-YEAST	TCA cycle, aerobic respiration
PWY-7279-YEAST	aerobic respiration (cytochrome c)
PWY-7279	aerobic respiration (cytochrome c) (yeast)
PWY3O-188	aerobic respiration (linear view)

REACTOME Pathway ID	Description
5618051	Citric acid cycle (TCA cycle)
5618023	Metabolism
5618052	Pyruvate metabolism and Citric Acid (TCA) cycle
5618290	Respiratory electron transport
5618291	Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.
5618053	The citric acid (TCA) cycle and respiratory electron transport

Accession	Description
IPR000701	Succ_DH_Fumarate_Rdtase_TM-su
IPR018495	Succ_DH_cyt_bsu_CS

Gene Name

succinate dehydrogenase cytochrome b subunit SDH3

Protein Entry

SDH3_YEAST

UniProt ID

Species

Yeast (S288c)

Comment Type	Description
Cofactor	Name=heme; Xref=ChEBI:CHEBI:30413; Note=The heme is bound between the two transmembrane subunits.;
Function	Membrane-anchoring mono-heme cytochrome b subunit of succinate dehydrogenase (SDH) that is involved in system II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). SDH3 and SDH4 form the membrane dimer that anchors the catalytic dimer formed by SDH1 and SDH2 to the matrix surface of the mitochondrial inner membrane. Electrons originating from the catalytic dimer enter the membrane dimer for ubiquinone reduction.
Miscellaneous	Present with 238 molecules/cell in log phase SD medium
Miscellaneous	Present with 238 molecules/cell in log phase SD medium. {ECO:0000269\|PubMed:14562106}.
Pathway	Carbohydrate metabolism; tricarboxylic acid cycle.
Similarity	Belongs to the cytochrome b560 family
Similarity	Belongs to the cytochrome b560 family. {ECO:0000305}.
Subcellular Location	Mitochondrion inner membrane; Multi-pass membrane protein.
Subunit	Forms part of complex II containing four subunits: a flavoprotein (FP), an iron-sulfur protein (IP) and a cytochrome b composed of two integral membrane proteins.