Gene/Proteome Database (LMPD)
Proteins
| palmitoyl-(protein) hydrolase | |
|---|---|
| Refseq ID | NP_013219 |
| Protein GI | 6323147 |
| UniProt ID | Q12354 |
| mRNA ID | NM_001182005 |
| Length | 227 |
| RefSeq Status | PROVISIONAL |
| MNGLRVAAKIQPARQTIIFLHGLGDTGSGWGFLAQYLQQRDPAAFQHTNFVFPNAPELHVTANGGALMPAWFDILEWDPSFSKVDSDGFMNSLNSIEKTVKQEIDKGIKPEQIIIGGFSQGAALALATSVTLPWKIGGIVALSGFCSIPGILKQHKNGINVKTPIFHGHGDMDPVVPIGLGIKAKQFYQDSCEIQNYEFKVYKGMAHSTVPDELEDLASFIKKSLSS | |
Gene Information
Entrez Gene ID
Gene Name
palmitoyl-(protein) hydrolase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0052689 | IEA:UniProtKB-KW | F | carboxylic ester hydrolase activity |
| GO:0008474 | IDA:SGD | F | palmitoyl-(protein) hydrolase activity |
| GO:0006631 | IEA:UniProtKB-KW | P | fatty acid metabolic process |
| GO:0098734 | IDA:GOC | P | macromolecule depalmitoylation |
| GO:0035601 | IDA:SGD | P | protein deacylation |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
palmitoyl-(protein) hydrolase
Protein Entry
APTH1_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-protein + H(2)O = palmitate + protein. {ECO:0000269|PubMed:12080046}. |
| Function | Hydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates. Mediates the deacylation of G-alpha proteins such as GPA1 in vivo, but has weak or no activity toward palmitoylated Ras proteins. Has weak lysophospholipase activity in vitro; however such activity may not exist in vivo. {ECO:0000269|PubMed:12080046}. |
| Miscellaneous | Present with 1480 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the AB hydrolase superfamily. AB hydrolase 2 family. {ECO:0000305}. |
| Subcellular Location | Cytoplasm {ECO:0000269|PubMed:14562095}. Nucleus {ECO:0000269|PubMed:14562095}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007012 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6323147 | RefSeq | NP_013219 | 227 | palmitoyl-(protein) hydrolase |
Identical Sequences to LMP007012 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6323147 | GenBank | EIW08735.1 | 227 | hypothetical protein CENPK1137D_505 [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:6323147 | GenBank | EWG84381.1 | 227 | hypothetical protein R008_L11146 [Saccharomyces cerevisiae R008] |
| GI:6323147 | GenBank | EWG89898.1 | 227 | hypothetical protein P301_L20811 [Saccharomyces cerevisiae P301] |
| GI:6323147 | GenBank | EWG94721.1 | 227 | hypothetical protein R103_L21041 [Saccharomyces cerevisiae R103] |
| GI:6323147 | GenBank | EWH17277.1 | 227 | hypothetical protein P283_L11151 [Saccharomyces cerevisiae P283] |
| GI:6323147 | gnl | McCuskerlabDuke | 227 | hypothetical protein H779_YJM993L00179 [Saccharomyces cerevisiae YJM993] |
Related Sequences to LMP007012 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6323147 | DBBJ | GAA25003.1 | 227 | K7_Ylr118cp [Saccharomyces cerevisiae Kyokai no. 7] |
| GI:6323147 | GenBank | EGA57665.1 | 227 | YLR118C-like protein [Saccharomyces cerevisiae FostersB] |
| GI:6323147 | GenBank | EGA61379.1 | 227 | YLR118C-like protein [Saccharomyces cerevisiae FostersO] |
| GI:6323147 | GenBank | EGA73957.1 | 160 | YLR118C-like protein [Saccharomyces cerevisiae AWRI796] |
| GI:6323147 | GenBank | EGA81736.1 | 190 | YLR118C-like protein [Saccharomyces cerevisiae Lalvin QA23] |
| GI:6323147 | GenBank | EHN01221.1 | 227 | YLR118C-like protein [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7] |