Gene/Proteome Database (LMPD)
LMPD ID
LMP006977
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase
Gene Symbol
Synonyms
-
Alternate Names
bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase
Chromosome
XI
EC Number
4.1.3.27
Proteins
| bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase | |
|---|---|
| Refseq ID | NP_012711 |
| Protein GI | 6322638 |
| UniProt ID | P00937 |
| mRNA ID | NM_001179776 |
| Length | 484 |
| RefSeq Status | PROVISIONAL |
| MSVHAATNPINKHVVLIDNYDSFTWNVYEYLCQEGAKVSVYRNDAITVPEIAALNPDTLLISPGPGHPKTDSGISRDCIRYFTGKIPVFGICMGQQCMFDVFGGEVAYAGEIVHGKTSPISHDNCGIFKNVPQGIAVTRYHSLAGTESSLPSCLKVTASTENGIIMGVRHKKYTVEGVQFHPESILTEEGHLMIRNILNVSGGTWEENKSSPSNSILDRIYARRKIDVNEQSKIPGFTFQDLQSNYDLGLAPPLQDFYTVLSSSHKRAVVLAEVKRASPSKGPICLKAVAAEQALKYAEAGASAISVLTEPHWFHGSLQDLVNVRKILDLKFPPKERPCVLRKEFIFSKYQILEARLAGADTVLLIVKMLSQPLLKELYSYSKDLNMEPLVEVNSKEELQRALEIGAKVVGVNNRDLHSFNVDLNTTSNLVESIPKDVLLIALSGITTRDDAEKYKKEGVHGFLVGEALMKSTDVKKFIHELCE | |
Gene Information
Entrez Gene ID
Gene Name
bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005950 | IPI:SGD | C | anthranilate synthase complex |
| GO:0004049 | IEA:UniProtKB-EC | F | anthranilate synthase activity |
| GO:0004425 | IMP:SGD | F | indole-3-glycerol-phosphate synthase activity |
| GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
| GO:0006541 | IEA:UniProtKB-KW | P | glutamine metabolic process |
| GO:0000162 | IMP:SGD | P | tryptophan biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| sce01230 | Biosynthesis of amino acids |
| sce_M00023 | Tryptophan biosynthesis, chorismate => tryptophan |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| COMPLETE-ARO-YEAST-PWY | superpathway of phenylalanine, tyrosine and tryptophan biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR013785 | Aldolase-type TIM barrel |
| IPR006221 | Anthranilate synthase/para-aminobenzoate synthase like domain |
| IPR029062 | Class I glutamine amidotransferase-like |
| IPR017926 | Glutamine amidotransferase |
| IPR013798 | Indole-3-glycerol phosphate synthase |
| IPR001468 | Indole-3-glycerol phosphate synthase, conserved site |
| IPR011060 | Ribulose-phosphate binding barrel |
UniProt Annotations
Entry Information
Gene Name
bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase
Protein Entry
TRPG_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5- phosphate = 1-C-(3-indolyl)-glycerol 3-phosphate + CO(2) + H(2)O. |
| Catalytic Activity | Chorismate + L-glutamine = anthranilate + pyruvate + L-glutamate. |
| Induction | By tryptophan starvation. |
| Interaction | P00899:TRP2; NbExp=4; IntAct=EBI-19585, EBI-19575; |
| Miscellaneous | Component I catalyzes the formation of anthranilate using ammonia rather than glutamine, whereas component II provides glutamine amidotransferase activity. |
| Miscellaneous | Present with 13400 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Miscellaneous | Yeast component II C-terminal half also has indole- 3-glycerol phosphate synthase activity. |
| Pathway | Amino-acid biosynthesis; L-tryptophan biosynthesis; L- tryptophan from chorismate: step 1/5. |
| Pathway | Amino-acid biosynthesis; L-tryptophan biosynthesis; L- tryptophan from chorismate: step 4/5. |
| Similarity | Contains 1 glutamine amidotransferase type-1 domain. {ECO:0000255|PROSITE-ProRule:PRU00605}. |
| Subunit | Tetramer of two components I and two components II. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006977 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6322638 | RefSeq | NP_012711 | 484 | bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase |
Identical Sequences to LMP006977 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6322638 | DBBJ | GAA24526.1 | 484 | K7_Trp3p [Saccharomyces cerevisiae Kyokai no. 7] |
| GI:6322638 | GenBank | EIW09155.1 | 484 | Trp3p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:6322638 | GenBank | EWG84662.1 | 484 | Trp3p [Saccharomyces cerevisiae R008] |
| GI:6322638 | GenBank | EWG89976.1 | 484 | Trp3p [Saccharomyces cerevisiae P301] |
| GI:6322638 | gnl | McCuskerlabDuke | 484 | Trp3p [Saccharomyces cerevisiae YJM993] |
| GI:6322638 | Third Party Genbank | DAA08958.1 | 484 | TPA: bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP006977 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6322638 | GenBank | AAA35176.1 | 484 | anthranilate synthase Component II:indole-3-glycerol phosphate synthase (TRP3) [Saccharomyces cerevisiae] |
| GI:6322638 | GenBank | EEU09210.1 | 484 | Trp3p [Saccharomyces cerevisiae JAY291] |
| GI:6322638 | GenBank | EGA78105.1 | 466 | Trp3p [Saccharomyces cerevisiae Vin13] |
| GI:6322638 | GenBank | EHN06007.1 | 484 | Trp3p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7] |
| GI:6322638 | GenBank | EJT42155.1 | 484 | TRP3-like protein [Saccharomyces kudriavzevii IFO 1802] |
| GI:6322638 | GenBank | EWH17464.1 | 484 | Trp3p [Saccharomyces cerevisiae P283] |