Gene/Proteome Database (LMPD)
Proteins
| Ste14p | |
|---|---|
| Refseq ID | NP_010698 |
| Protein GI | 6320618 |
| UniProt ID | P32584 |
| mRNA ID | NM_001180718 |
| Length | 239 |
| RefSeq Status | PROVISIONAL |
| MHQDFQEDEHEYPDIRRNPLHEVTMTSYILGILLGIFVGLFPQIRFKNFNLFIIALSLFHFLEYYITAKYNPLKVHSESFLLNNGKSYMAAHSFAILECLVESFLFPDLKIFSYSLATKLCTVLGCLLVILGQYTRTIAMHTAGHSFSHIVKTKKESDHVLVKTGVYSWSRHPSYLGFFWWAIGTQLLLLNPLSLVIFIFVLWKFFSDRIRVEEKYLIEFFSAEYIEYKNKVGVGIPFI | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | IDA:SGD | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005637 | IMP:SGD | C | nuclear inner membrane |
| GO:0004671 | IDA:SGD | F | protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity |
| GO:0006481 | IMP:SGD | P | C-terminal protein methylation |
| GO:0007323 | IMP:SGD | P | peptide pheromone maturation |
| GO:0019236 | IEA:UniProtKB-KW | P | response to pheromone |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | S-adenosyl-L-methionine + protein C-terminal S-farnesyl-L-cysteine = S-adenosyl-L-homocysteine + protein C- terminal S-farnesyl-L-cysteine methyl ester. |
| Function | Mediates C-terminal methylation of the isoprenylated C- terminal cysteine in A-factor mating pheromone and Ras proteins. {ECO:0000269|PubMed:8289819}. |
| Miscellaneous | Present with 2690 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the class VI-like SAM-binding methyltransferase superfamily. Isoprenylcysteine carboxyl methyltransferase family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006862 (as displayed in Record Overview)
Identical Sequences to LMP006862 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6320618 | GenBank | AAE71089.1 | 239 | Sequence 11 from patent US 6232108 |
| GI:6320618 | GenBank | AAN26459.1 | 239 | Sequence 11 from patent US 6432403 |
| GI:6320618 | GenBank | EIW11620.1 | 239 | Ste14p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:6320618 | GenBank | EWH19101.1 | 239 | Ste14p [Saccharomyces cerevisiae P283] |
| GI:6320618 | gnl | McCuskerlabDuke | 239 | Ste14p [Saccharomyces cerevisiae YJM993] |
| GI:6320618 | Third Party Genbank | DAA12252.1 | 239 | TPA: Ste14p [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP006862 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6320618 | EMBL | CAY78912.1 | 239 | Ste14p [Saccharomyces cerevisiae EC1118] |
| GI:6320618 | GenBank | EDV07923.1 | 239 | protein-S-isoprenylcysteine O-methyltransferase [Saccharomyces cerevisiae RM11-1a] |
| GI:6320618 | GenBank | EDZ72855.1 | 239 | YDR410Cp-like protein [Saccharomyces cerevisiae AWRI1631] |
| GI:6320618 | GenBank | EEU04288.1 | 239 | Ste14p [Saccharomyces cerevisiae JAY291] |
| GI:6320618 | GenBank | EGA75436.1 | 239 | Ste14p [Saccharomyces cerevisiae AWRI796] |
| GI:6320618 | GenBank | EWG86747.1 | 239 | Ste14p [Saccharomyces cerevisiae R008] |