Gene/Proteome Database (LMPD)
Proteins
| Pex11p | |
|---|---|
| Refseq ID | NP_014494 |
| Protein GI | 6324425 |
| UniProt ID | Q12462 |
| mRNA ID | NM_001183401 |
| Length | 236 |
| MVCDTLVYHPSVTRFVKFLDGSAGREKVLRLLQYLARFLAVQNSSLLARQLQAQFTTVRKFLRFLKPLNHLQAAAKFYDNKLASDNVVRVCNVLKNIFFAAYLSLDQVNLLRILKVIPVTVLTGKKIPRWSNWCWLFGLLSGLAMDLRKIQTSHAQIAAFVKAKSQSQGDEHEDHKKVLGKAYQDRYTALRRLFWDAADSFIVLNNLGYLSSNEEYVALSGVVTSILGMQDMWKAT | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
| GO:0005779 | ISS:UniProtKB | C | integral component of peroxisomal membrane |
| GO:1990429 | IDA:SGD | C | peroxisomal importomer complex |
| GO:0005778 | IDA:SGD | C | peroxisomal membrane |
| GO:0005777 | IDA:UniProtKB | C | peroxisome |
| GO:0019395 | IMP:SGD | P | fatty acid oxidation |
| GO:0016559 | IDA:UniProtKB | P | peroxisome fission |
| GO:0007031 | ISS:UniProtKB | P | peroxisome organization |
| GO:0044375 | IDA:UniProtKB | P | regulation of peroxisome size |
| GO:0007165 | ISS:UniProtKB | P | signal transduction |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5618090 | Fatty acid, triacylglycerol, and ketone body metabolism |
| 5618023 | Metabolism |
| 5618091 | Metabolism of lipids and lipoproteins |
| 5618608 | PPARA activates gene expression |
| 5618609 | Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR008733 | PEX11 |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Involved in peroxisomal proliferation. Promotes peroxisome division and biogenesis. {ECO:0000269|PubMed:14517321, ECO:0000269|PubMed:14517338, ECO:0000269|PubMed:21441307}. |
| Miscellaneous | Present with 1630 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 1630 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the peroxin-11 family |
| Similarity | Belongs to the peroxin-11 family. {ECO:0000305}. |
| Subcellular Location | Peroxisome membrane ; Peripheral membrane protein {ECO:0000269|PubMed:14517338, ECO:0000269|PubMed:14562095}. |
| Subcellular Location | Peroxisome membrane {ECO:0000269|PubMed:14517338, ECO:0000269|PubMed:14562095}; Peripheral membrane protein {ECO:0000269|PubMed:14517338, ECO:0000269|PubMed:14562095}. |
| Subunit | Homooligomer. Interacts with PEX34. {ECO:0000269|PubMed:14517321, ECO:0000269|PubMed:14517338, ECO:0000269|PubMed:21441307}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006846 (as displayed in Record Overview)
Identical Sequences to LMP006846 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP006846 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|