Gene/Proteome Database (LMPD)

LMPD ID
LMP006844
Gene ID
851433
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
aldo-keto reductase superfamily protein
Gene Symbol
YDL124W
Synonyms
-
Alternate Names
aldo-keto reductase superfamily protein
Chromosome
IV
EC Number
1.2.1.-

Proteins

aldo-keto reductase superfamily protein
Refseq ID NP_010159
Protein GI 6320079
UniProt ID Q07551
mRNA ID NM_001180183
Length 312
RefSeq Status PROVISIONAL
MSFHQQFFTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYPEVGKALSLTEKPRNAIFLTDKYSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSPFVSKEVNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQRILKVAEVKPQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQPFFEYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVDKITELGLEHEPLRLYWNKLYGKYNYAAQKV

Gene Information

Entrez Gene ID
851433
Gene Name
aldo-keto reductase superfamily protein
Gene Symbol
YDL124W
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0004032 IDA:SGD F alditol:NADP+ 1-oxidoreductase activity
GO:0004033 IDA:SGD F aldo-keto reductase (NADP) activity
GO:0051268 IDA:SGD F alpha-keto amide reductase activity
GO:0051269 IDA:SGD F alpha-keto ester reductase activity
GO:0043603 IDA:SGD P cellular amide metabolic process
GO:0006725 IDA:SGD P cellular aromatic compound metabolic process
GO:0042180 IDA:SGD P cellular ketone metabolic process
GO:0034599 IGI:SGD P cellular response to oxidative stress

Domain Information

InterPro Annotations

Accession Description
IPR001395 Aldo/keto reductase
IPR020471 Aldo/keto reductase subgroup
IPR018170 Aldo/keto reductase, conserved site
IPR023210 NADP-dependent oxidoreductase domain

UniProt Annotations

Entry Information

Gene Name
aldo-keto reductase superfamily protein
Protein Entry
KAR_YEAST
UniProt ID
Q07551
Species
Yeast (S288c)

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=146 uM for o-chlorobenzoylformamide {ECO:0000269|PubMed:15564669}; KM=156 uM for m-chlorobenzoylformamide {ECO:0000269|PubMed:15564669}; KM=231 uM for p-chlorobenzoylformamide {ECO:0000269|PubMed:15564669}; KM=103 uM for benzoylformamide {ECO:0000269|PubMed:15564669}; KM=254 uM for 3-methyl-2-oxobutanoate {ECO:0000269|PubMed:15564669}; pH dependence: Stable from pH 6 to 9.5. {ECO:0000269|PubMed:15564669}; Temperature dependence: Thermostable up to 40 degrees Celsius. {ECO:0000269|PubMed:15564669};
Function Reduces aromatic alpha-keto amides, aliphatic and aromatic alpha-keto esters, but not beta-keto esters. {ECO:0000269|PubMed:11306085}.
Induction Transiently induced shortly after the switch from aerobic to anaerobic growth (at protein level). {ECO:0000269|PubMed:12627397}.
Miscellaneous Present with 4030 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Ptm The N-terminus is blocked.
Similarity Belongs to the aldo/keto reductase family. {ECO:0000305}.
Subcellular Location Cytoplasm {ECO:0000269|PubMed:14562095}. Nucleus {ECO:0000269|PubMed:14562095}.
Subunit Monomer. {ECO:0000269|PubMed:15564669}.

Identical and Related Proteins

Unique RefSeq proteins for LMP006844 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6320079 RefSeq NP_010159 312 aldo-keto reductase superfamily protein

Identical Sequences to LMP006844 proteins

Reference Database Accession Length Protein Name
GI:6320079 GenBank AGB63054.1 312 Sequence 40 from patent US 8288141
GI:6320079 GenBank AGJ48655.1 312 Sequence 138 from patent US 8415126
GI:6320079 GenBank AGM77562.1 312 Sequence 86 from patent US 8426178
GI:6320079 GenBank AGV94528.1 312 Sequence 110 from patent US 8512973
GI:6320079 GenBank AHH57942.1 312 Sequence 122 from patent US 8617853
GI:6320079 GenBank AHH58047.1 312 Sequence 2 from patent US 8617864

Related Sequences to LMP006844 proteins

Reference Database Accession Length Protein Name
GI:6320079 GenBank AED33119.1 312 Sequence 16 from patent US 7879585
GI:6320079 GenBank AED33135.1 312 Sequence 48 from patent US 7879585
GI:6320079 GenBank AFT61367.1 312 Sequence 16 from patent US 8273547
GI:6320079 GenBank AFT61383.1 312 Sequence 48 from patent US 8273547
GI:6320079 GenBank AHH58054.1 312 Sequence 16 from patent US 8617864
GI:6320079 GenBank AHH58070.1 312 Sequence 48 from patent US 8617864