Gene/Proteome Database (LMPD)
LMPD ID
LMP006739
Gene ID
Species
Homo sapiens (Human)
Gene Name
aldo-keto reductase family 1, member C2
Gene Symbol
Synonyms
AKR1C-pseudo; BABP; DD; DD-2; DD/BABP; DD2; DDH2; HAKRD; HBAB; MCDR2; SRXY8; TDD
Alternate Names
aldo-keto reductase family 1 member C2; 3-alpha-HSD3; pseudo-chlordecone reductase; type II dihydrodiol dehydrogenase; chlordecone reductase homolog HAKRD; testicular 17,20-desmolase deficiency; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III
Chromosome
10
Map Location
10p15-p14
EC Number
1.-.-.-
Summary
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
Orthologs
Proteins
| aldo-keto reductase family 1 member C2 isoform 1 | |
|---|---|
| Refseq ID | NP_001345 |
| Protein GI | 4503285 |
| UniProt ID | P52895 |
| mRNA ID | NM_001354 |
| Length | 323 |
| RefSeq Status | REVIEWED |
| MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY | |
| aldo-keto reductase family 1 member C2 isoform 1 | |
|---|---|
| Refseq ID | NP_995317 |
| Protein GI | 45446745 |
| UniProt ID | P52895 |
| mRNA ID | NM_205845 |
| Length | 323 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:4503285 (mRNA isoform) | |
| aldo-keto reductase family 1 member C2 isoform 2 | |
|---|---|
| Refseq ID | NP_001128713 |
| Protein GI | 207028673 |
| UniProt ID | P52895 |
| mRNA ID | NM_001135241 |
| Length | 139 |
| RefSeq Status | REVIEWED |
| MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKEDIGILTWKKSPKHNS | |
Gene Information
Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member C2
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0004032 | IDA:UniProtKB | F | alditol:NADP+ 1-oxidoreductase activity |
| GO:0032052 | IDA:UniProtKB | F | bile acid binding |
| GO:0031406 | IDA:UniProtKB | F | carboxylic acid binding |
| GO:0047086 | IDA:UniProtKB | F | ketosteroid monooxygenase activity |
| GO:0016655 | IDA:UniProtKB | F | oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor |
| GO:0018636 | IDA:UniProtKB | F | phenanthrene 9,10-monooxygenase activity |
| GO:0004958 | IDA:UniProtKB | F | prostaglandin F receptor activity |
| GO:0047115 | IDA:UniProtKB | F | trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity |
| GO:0007186 | IDA:UniProtKB | P | G-protein coupled receptor signaling pathway |
| GO:0071395 | IDA:UniProtKB | P | cellular response to jasmonic acid stimulus |
| GO:0044597 | IMP:UniProtKB | P | daunorubicin metabolic process |
| GO:0007586 | IDA:UniProtKB | P | digestion |
| GO:0044598 | IMP:UniProtKB | P | doxorubicin metabolic process |
| GO:0030855 | IEP:UniProt | P | epithelial cell differentiation |
| GO:0055114 | IDA:UniProtKB | P | oxidation-reduction process |
| GO:0008284 | IDA:UniProtKB | P | positive regulation of cell proliferation |
| GO:0051897 | IDA:UniProtKB | P | positive regulation of protein kinase B signaling |
| GO:0042448 | IDA:UniProtKB | P | progesterone metabolic process |
| GO:0006693 | IDA:UniProtKB | P | prostaglandin metabolic process |
| GO:0034694 | IDA:UniProtKB | P | response to prostaglandin |
| GO:0008202 | IDA:UniProtKB | P | steroid metabolic process |
KEGG Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_11048 | Synthesis of bile acids and bile salts via 27-hydroxycholesterol |
Domain Information
UniProt Annotations
Entry Information
Gene Name
aldo-keto reductase family 1, member C2
Protein Entry
AK1C2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P52895-1; Sequence=Displayed; Name=2; IsoId=P52895-2; Sequence=VSP_043779, VSP_043780; Note=No experimental confirmation available.; |
| Biophysicochemical Properties | Kinetic parameters: KM=260 uM for (s)-tetralol ; KM=520 uM for (s)-indan-1-ol ; KM=5000 uM for benzene dihydrodiol ; KM=1 uM for 5-beta-pregnane-3-alpha,20-alpha-diol ; KM=208 uM for 9-alpha,11-beta-PGF2 ; KM=0.3 uM for 5-beta-androstane-3,17-dione ; KM=79 uM for PGD2 ; |
| Catalytic Activity | A 3-alpha-hydroxysteroid + NAD(P)(+) = a 3- oxosteroid + NAD(P)H. |
| Catalytic Activity | Trans-1,2-dihydrobenzene-1,2-diol + NADP(+) = catechol + NADPH. |
| Disease | 46,XY sex reversal 8 (SRXY8) [MIM |
| Enzyme Regulation | Inhibited by hexestrol with an IC(50) of 2.8 uM, 1,10-phenanthroline with an IC(50) of 2100 uM, 1,7- phenanthroline with an IC(50) of 1500 uM, flufenamic acid with an IC(50) of 0.9 uM, indomethacin with an IC(50) of 75 uM, ibuprofen with an IC(50) of 6.9 uM, lithocholic acid with an IC(50) of 0.07 uM, ursodeoxycholic acid with an IC(50) of 0.08 uM and chenodeoxycholic acid with an IC(50) of 0.13 uM. |
| Function | Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha- DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Has a high bile-binding ability. {ECO |
| Similarity | Belongs to the aldo/keto reductase family. |
| Subcellular Location | Cytoplasm . |
| Tissue Specificity | Expressed in fetal testes. Expressed in fetal and adult adrenal glands. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006739 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4503285 | RefSeq | NP_001345 | 323 | aldo-keto reductase family 1 member C2 isoform 1 |
| 207028673 | RefSeq | NP_001128713 | 139 | aldo-keto reductase family 1 member C2 isoform 2 |
Identical Sequences to LMP006739 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:207028673 | DBBJ | BAG59281.1 | 139 | unnamed protein product [Homo sapiens] |
| GI:4503285 | GenBank | ADT47546.1 | 323 | Sequence 1207 from patent US 7842466 |
| GI:4503285 | GenBank | AEN35373.1 | 323 | Sequence 1301 from patent US 7998689 |
| GI:4503285 | GenBank | AHD75593.1 | 323 | Sequence 17976 from patent US 8586006 |
| GI:4503285 | GenBank | AHD75594.1 | 323 | Sequence 17977 from patent US 8586006 |
| GI:4503285 | GenBank | AIC48626.1 | 323 | AKR1C2, partial [synthetic construct] |
| GI:4503285 | GenBank | AIC62976.1 | 323 | AKR1C2, partial [synthetic construct] |
Related Sequences to LMP006739 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4503285 | GenBank | AAP36771.1 | 324 | Homo sapiens aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III), partial [synthetic construct] |
| GI:4503285 | GenBank | AAX29399.1 | 324 | aldo-keto reductase family 1 member C2, partial [synthetic construct] |
| GI:4503285 | GenBank | AAX29400.1 | 324 | aldo-keto reductase family 1 member C2, partial [synthetic construct] |
| GI:207028673 | GenBank | ADT47546.1 | 323 | Sequence 1207 from patent US 7842466 |
| GI:207028673 | GenBank | AIC48626.1 | 323 | AKR1C2, partial [synthetic construct] |
| GI:4503285 | PDB | 4JQ1 | 331 | Chain B, Akr1c2 Complex With Naproxen |
| GI:4503285 | PDB | 4JQ2 | 331 | Chain A, Akr1c2 Complex With Sulindac |
| GI:4503285 | PDB | 4JQ2 | 331 | Chain B, Akr1c2 Complex With Sulindac |
| GI:207028673 | RefSeq | XP_004049051.1 | 139 | PREDICTED: aldo-keto reductase family 1 member C1-like [Gorilla gorilla gorilla] |
| GI:207028673 | RefSeq | XP_005564596.1 | 139 | PREDICTED: aldo-keto reductase family 1 member C1 homolog isoform X3 [Macaca fascicularis] |
| GI:207028673 | RefSeq | XP_010382635.1 | 139 | PREDICTED: aldo-keto reductase family 1 member C1 homolog isoform X3 [Rhinopithecus roxellana] |
| GI:207028673 | SwissProt | P52895.3 | 323 | RecName: Full=Aldo-keto reductase family 1 member C2; AltName: Full=3-alpha-HSD3; AltName: Full=Chlordecone reductase homolog HAKRD; AltName: Full=Dihydrodiol dehydrogenase 2; Short=DD-2; Short=DD2; AltName: Full=Dihydrodiol dehydrogenase/bile acid-binding protein; Short=DD/BABP; AltName: Full=Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; AltName: Full=Type III 3-alpha-hydroxysteroid dehydrogenase [Homo sapiens] |