Gene/Proteome Database (LMPD)
Proteins
| sphingomyelin synthase-related protein 1 isoform 1 | |
|---|---|
| Refseq ID | NP_001167627 |
| Protein GI | 292658773 |
| UniProt ID | Q96LT4 |
| mRNA ID | NM_001174156 |
| Length | 415 |
| RefSeq Status | VALIDATED |
| MAGPNQLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTDWLCNGELSHDCDGPITDLNSDQYQYMNGKNKHSVRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGSVWEKLHRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRAYQQSRRARIWFPMFSFFECNVNGTVPNEYCWPFSKPAIMKRLIG | |
| sphingomyelin synthase-related protein 1 isoform 2 | |
|---|---|
| Refseq ID | NP_653261 |
| Protein GI | 21389545 |
| UniProt ID | Q96LT4 |
| mRNA ID | NM_144660 |
| Length | 326 |
| RefSeq Status | VALIDATED |
| MAGPNQLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTDWLCNGELSHDCDGPITDLNSDQYQYMNGKNKHSVRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGSVWEKLHRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTECKYLFSASMRIR | |
Gene Information
Entrez Gene ID
Gene Name
sterile alpha motif domain containing 8
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030176 | IDA:UniProtKB | C | integral component of endoplasmic reticulum membrane |
| GO:0016021 | NAS:UniProtKB | C | integral component of membrane |
| GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
| GO:0046513 | IDA:UniProtKB | P | ceramide biosynthetic process |
| GO:2000303 | IDA:UniProtKB | P | regulation of ceramide biosynthetic process |
| GO:0006686 | NAS:UniProtKB | P | sphingomyelin biosynthetic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY3DJ-11281 | sphingomyelin metabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
sterile alpha motif domain containing 8
Protein Entry
Q96LT4_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96LT4-1; Sequence=Displayed; Name=2; IsoId=Q96LT4-2; Sequence=VSP_038403, VSP_038404; |
| Domain | The SAM domain is required to retain SMAD8 in the endoplasmic reticulum. |
| Function | Sphingomyelin synthases synthesize sphingolipids through transfer of a phosphatidyl head group on to the primary hydroxyl of ceramide. SAMD8 is an endoplasmic reticulum (ER) transferase that has no sphingomyelin synthase activity but can convert phosphatidylethanolamine (PE) and ceramide to ceramide phosphoethanolamine (CPE) albeit with low product yield. Appears to operate as a ceramide sensor to control ceramide homeostasis in the endoplasmic reticulum rather than a converter of ceramides. Seems to be critical for the integrity of the early secretory pathway. |
| Sequence Caution | Sequence=AAH80593.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; |
| Similarity | Belongs to the sphingomyelin synthase family. |
| Similarity | Contains 1 SAM (sterile alpha motif) domain. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP006697 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 292658773 | RefSeq | NP_001167627 | 415 | sphingomyelin synthase-related protein 1 isoform 1 |
| 21389545 | RefSeq | NP_653261 | 326 | sphingomyelin synthase-related protein 1 isoform 2 |
Identical Sequences to LMP006697 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21389545 | DBBJ | BAJ17800.1 | 326 | sterile alpha motif domain containing 8, partial [synthetic construct] |
| GI:21389545 | GenBank | EAW54568.1 | 326 | sterile alpha motif domain containing 8, isoform CRA_c [Homo sapiens] |
| GI:21389545 | GenBank | AAI40220.1 | 326 | Sterile alpha motif domain containing 8, partial [synthetic construct] |
| GI:21389545 | GenBank | AAI46557.1 | 326 | Sterile alpha motif domain containing 8 [synthetic construct] |
| GI:21389545 | GenBank | ACF94485.1 | 326 | epididymis luminal protein 177 [Homo sapiens] |
| GI:292658773 | GenBank | JAA38583.1 | 415 | sterile alpha motif domain containing 8 [Pan troglodytes] |
| GI:292658773 | GenBank | JAA38584.1 | 415 | sterile alpha motif domain containing 8 [Pan troglodytes] |
| GI:21389545 | RefSeq | XP_004049677.1 | 326 | PREDICTED: sphingomyelin synthase-related protein 1 [Gorilla gorilla gorilla] |
| GI:292658773 | RefSeq | XP_005269598.1 | 415 | PREDICTED: sphingomyelin synthase-related protein 1 isoform X2 [Homo sapiens] |
| GI:292658773 | RefSeq | XP_009457045.1 | 415 | PREDICTED: sphingomyelin synthase-related protein 1 isoform X2 [Pan troglodytes] |
| GI:292658773 | RefSeq | XP_010348767.1 | 415 | PREDICTED: sphingomyelin synthase-related protein 1 isoform X1 [Saimiri boliviensis boliviensis] |
| GI:292658773 | RefSeq | XP_010348768.1 | 415 | PREDICTED: sphingomyelin synthase-related protein 1 isoform X1 [Saimiri boliviensis boliviensis] |
Related Sequences to LMP006697 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:292658773 | GenBank | AAH80593.1 | 449 | SAMD8 protein, partial [Homo sapiens] |
| GI:21389545 | GenBank | EAW54565.1 | 389 | sterile alpha motif domain containing 8, isoform CRA_a [Homo sapiens] |
| GI:292658773 | GenBank | EAW54566.1 | 478 | sterile alpha motif domain containing 8, isoform CRA_b [Homo sapiens] |
| GI:21389545 | RefSeq | XP_001096809.2 | 389 | PREDICTED: sphingomyelin synthase-related protein 1 isoform 2 [Macaca mulatta] |
| GI:21389545 | RefSeq | XP_003939828.1 | 326 | PREDICTED: sphingomyelin synthase-related protein 1 isoform X2 [Saimiri boliviensis boliviensis] |
| GI:21389545 | RefSeq | XP_004426989.1 | 326 | PREDICTED: sphingomyelin synthase-related protein 1 isoform 2 [Ceratotherium simum simum] |
| GI:21389545 | RefSeq | XP_007938777.1 | 344 | PREDICTED: sphingomyelin synthase-related protein 1 isoform X1 [Orycteropus afer afer] |
| GI:21389545 | RefSeq | XP_008694304.1 | 326 | PREDICTED: sphingomyelin synthase-related protein 1 isoform X2 [Ursus maritimus] |
| GI:292658773 | RefSeq | XP_008963806.1 | 415 | PREDICTED: sphingomyelin synthase-related protein 1 [Pan paniscus] |
| GI:292658773 | RefSeq | XP_008963807.1 | 415 | PREDICTED: sphingomyelin synthase-related protein 1 [Pan paniscus] |
| GI:292658773 | RefSeq | XP_008963808.1 | 415 | PREDICTED: sphingomyelin synthase-related protein 1 [Pan paniscus] |
| GI:292658773 | RefSeq | XP_009457044.1 | 478 | PREDICTED: sphingomyelin synthase-related protein 1 isoform X1 [Pan troglodytes] |