Gene/Proteome Database (LMPD)
LMPD ID
LMP006694
Gene ID
Species
Homo sapiens (Human)
Gene Name
insulin induced gene 1
Gene Symbol
Synonyms
CL-6; CL6
Chromosome
7
Map Location
7q36
Summary
Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. It encodes an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. This protein binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jun 2009]
Orthologs
Proteins
| insulin-induced gene 1 protein isoform 1 | |
|---|---|
| Refseq ID | NP_005533 |
| Protein GI | 28882053 |
| UniProt ID | O15503 |
| mRNA ID | NM_005542 |
| Length | 277 |
| RefSeq Status | REVIEWED |
| MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD | |
| insulin-induced gene 1 protein isoform 2 | |
|---|---|
| Refseq ID | NP_938150 |
| Protein GI | 28882053 |
| UniProt ID | O15503 |
| mRNA ID | NM_198336 |
| Length | 277 |
| RefSeq Status | REVIEWED |
| MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD | |
| insulin-induced gene 1 protein isoform 3 | |
|---|---|
| Refseq ID | NP_938151 |
| Protein GI | 38327531 |
| UniProt ID | O15503 |
| mRNA ID | NM_198337 |
| Length | 164 |
| RefSeq Status | REVIEWED |
| MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAGIHPQISSIFVLGSLVYFSQEASRWGT | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0032937 | IDA:UniProtKB | C | SREBP-SCAP-Insig complex |
| GO:0005783 | IDA:UniProtKB | C | endoplasmic reticulum |
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0032933 | IDA:UniProtKB | P | SREBP signaling pathway |
| GO:0008283 | TAS:ProtInc | P | cell proliferation |
| GO:0006695 | IEA:Ensembl | P | cholesterol biosynthetic process |
| GO:0060363 | IEA:Ensembl | P | cranial suture morphogenesis |
| GO:0042472 | IEA:Ensembl | P | inner ear morphogenesis |
| GO:0008152 | TAS:ProtInc | P | metabolic process |
| GO:0042474 | IEA:Ensembl | P | middle ear morphogenesis |
| GO:1901303 | IMP:UniProtKB | P | negative regulation of cargo loading into COPII-coated vesicle |
| GO:0045599 | IEA:Ensembl | P | negative regulation of fat cell differentiation |
| GO:0045717 | IEA:Ensembl | P | negative regulation of fatty acid biosynthetic process |
| GO:0010894 | IEA:Ensembl | P | negative regulation of steroid biosynthetic process |
| GO:0060021 | IEA:Ensembl | P | palate development |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0006641 | IEA:Ensembl | P | triglyceride metabolic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_111217 | Metabolism |
| REACT_22258 | Metabolism of lipids and lipoproteins |
| REACT_147797 | Regulation of cholesterol biosynthesis by SREBP (SREBF) |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O15503-1; Sequence=Displayed; Name=2; IsoId=O15503-2; Sequence=VSP_045084, VSP_045085; Note=No experimental confirmation available.; |
| Function | Mediates feedback control of cholesterol synthesis by controlling SCAP and HMGCR. Functions by blocking the processing of sterol regulatory element-binding proteins (SREBPs). Capable of retaining the SCAP-SREBF2 complex in the ER thus preventing it from escorting SREBPs to the Golgi. Initiates the sterol-mediated ubiquitin-mediated endoplasmic reticulum-associated degradation (ERAD) of HMGCR via recruitment of the reductase to the ubiquitin ligase, AMFR/gp78. May play a role in growth and differentiation of tissues involved in metabolic control. May play a regulatory role during G0/G1 transition of cell growth. {ECO |
| Induction | By insulin. |
| Interaction | P00180:CYP2C1 (xeno); NbExp=2; IntAct=EBI-6252425, EBI-6251821; P00181:CYP2C2 (xeno); NbExp=3; IntAct=EBI-6252425, EBI-4320576; |
| Miscellaneous | Expressed at high levels when nuclear SREBP levels are high as a result of sterol deprivation. |
| Ptm | Ubiquitinated. Subsequent to sterol deprivation, the SCAP- SREBF2 complex becomes dissociated from INSIG1, is then ubiquitinated and degraded in proteasomes. Although ubiquitination is required for rapid INSIG1 degradation, it is not required for release of the SCAP-SREBP complex. Ubiquitinated by RNF139. |
| Similarity | Belongs to the INSIG family. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
| Subunit | Binds to the SCAP-SREBF2 complex only in the presence of sterols. Interacts with RNF139. Interacts with HMGCR (via its SSD); the interaction, accelerated by sterols, leads to the recruitment of HMGCR to AMFR/gp78 for its ubiquitination by the sterol-mediated ERAD pathway. Interacts with AMFR/gp78 (via its membrane domain); the interaction recruits HMCR at the ER membrane for its ubiquitination and degradation by the sterol-mediated ERAD pathway. {ECO |
| Tissue Specificity | Expressed in all tissues tested with highest expression in the liver. |
| Web Resource | Name=Wikipedia; Note=Insig1 entry; URL="http://en.wikipedia.org/wiki/Insig1"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP006694 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 28882053 | RefSeq | NP_005533 | 277 | insulin-induced gene 1 protein isoform 1 |
| 28882053 | RefSeq | NP_938150 | 277 | insulin-induced gene 1 protein isoform 2 |
| 38327531 | RefSeq | NP_938151 | 164 | insulin-induced gene 1 protein isoform 3 |
Identical Sequences to LMP006694 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:28882053 | DBBJ | BAF84364.1 | 277 | unnamed protein product [Homo sapiens] |
| GI:28882053 | DBBJ | BAF84364.1 | 277 | unnamed protein product [Homo sapiens] |
| GI:38327531 | GenBank | EAL23730.1 | 164 | insulin induced gene 1 [Homo sapiens] |
| GI:28882053 | GenBank | AAX32373.1 | 277 | insulin induced gene 1 [synthetic construct] |
| GI:28882053 | GenBank | AAX32373.1 | 277 | insulin induced gene 1 [synthetic construct] |
| GI:28882053 | GenBank | EAX04529.1 | 277 | insulin induced gene 1, isoform CRA_a [Homo sapiens] |
| GI:28882053 | GenBank | EAX04529.1 | 277 | insulin induced gene 1, isoform CRA_a [Homo sapiens] |
| GI:38327531 | GenBank | EAX04530.1 | 164 | insulin induced gene 1, isoform CRA_b [Homo sapiens] |
| GI:28882053 | GenBank | EAX04532.1 | 277 | insulin induced gene 1, isoform CRA_a [Homo sapiens] |
| GI:28882053 | GenBank | EAX04532.1 | 277 | insulin induced gene 1, isoform CRA_a [Homo sapiens] |
| GI:38327531 | GenBank | AED39026.1 | 164 | Sequence 861 from patent US 7883858 |
| GI:28882053 | GenBank | AIC49069.1 | 277 | INSIG1, partial [synthetic construct] |
| GI:28882053 | GenBank | AIC49069.1 | 277 | INSIG1, partial [synthetic construct] |
| GI:28882053 | SwissProt | O15503.3 | 277 | RecName: Full=Insulin-induced gene 1 protein; Short=INSIG-1 [Homo sapiens] |
| GI:28882053 | SwissProt | O15503.3 | 277 | RecName: Full=Insulin-induced gene 1 protein; Short=INSIG-1 [Homo sapiens] |
Related Sequences to LMP006694 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:28882053 | GenBank | AAP36909.1 | 278 | Homo sapiens insulin induced gene 1, partial [synthetic construct] |
| GI:28882053 | GenBank | AAP36909.1 | 278 | Homo sapiens insulin induced gene 1, partial [synthetic construct] |
| GI:28882053 | GenBank | AAX43961.1 | 278 | insulin induced gene 1, partial [synthetic construct] |
| GI:28882053 | GenBank | AAX43961.1 | 278 | insulin induced gene 1, partial [synthetic construct] |
| GI:28882053 | GenBank | AAX43962.1 | 278 | insulin induced gene 1, partial [synthetic construct] |
| GI:28882053 | GenBank | AAX43962.1 | 278 | insulin induced gene 1, partial [synthetic construct] |
| GI:28882053 | GenBank | ACM82662.1 | 278 | Sequence 8160 from patent US 6812339 |
| GI:28882053 | GenBank | ACM82662.1 | 278 | Sequence 8160 from patent US 6812339 |
| GI:38327531 | GenBank | JAA05650.1 | 164 | insulin induced gene 1 [Pan troglodytes] |
| GI:38327531 | GenBank | JAA21596.1 | 164 | insulin induced gene 1 [Pan troglodytes] |
| GI:38327531 | GenBank | JAA33454.1 | 164 | insulin induced gene 1 [Pan troglodytes] |
| GI:28882053 | RefSeq | XP_001145726.1 | 277 | PREDICTED: insulin-induced gene 1 protein isoform X2 [Pan troglodytes] |
| GI:28882053 | RefSeq | XP_001145726.1 | 277 | PREDICTED: insulin-induced gene 1 protein isoform X2 [Pan troglodytes] |
| GI:38327531 | RefSeq | XP_519478.2 | 164 | PREDICTED: insulin-induced gene 1 protein isoform X3 [Pan troglodytes] |
| GI:28882053 | RefSeq | XP_004046588.1 | 277 | PREDICTED: insulin-induced gene 1 protein isoform 1 [Gorilla gorilla gorilla] |
| GI:28882053 | RefSeq | XP_004046588.1 | 277 | PREDICTED: insulin-induced gene 1 protein isoform 1 [Gorilla gorilla gorilla] |
| GI:38327531 | RefSeq | XP_004046589.1 | 164 | PREDICTED: insulin-induced gene 1 protein isoform 2 [Gorilla gorilla gorilla] |
| GI:38327531 | RefSeq | XP_005551313.1 | 164 | PREDICTED: insulin-induced gene 1 protein isoform X2 [Macaca fascicularis] |