Gene/Proteome Database (LMPD)
LMPD ID
LMP006641
Gene ID
Species
Homo sapiens (Human)
Gene Name
choline phosphotransferase 1
Gene Symbol
Synonyms
CPT; CPT1
Alternate Names
cholinephosphotransferase 1; hCPT1; AAPT1-like protein; cholinephosphotransferase 1 alpha; phosphatidylcholine synthesizing enzyme; diacylglycerol cholinephosphotransferase 1
Chromosome
12
Map Location
12q
EC Number
2.7.8.2
Proteins
| cholinephosphotransferase 1 | |
|---|---|
| Refseq ID | NP_064629 |
| Protein GI | 50726996 |
| UniProt ID | Q8WUD6 |
| mRNA ID | NM_020244 |
| Length | 406 |
| RefSeq Status | VALIDATED |
| MAAGAGAGSAPRWLRALSEPLSAAQLRRLEEHRYSAAGVSLLEPPLQLYWTWLLQWIPLWMAPNSITLLGLAVNVVTTLVLISYCPTATEEAPYWTYLLCALGLFIYQSLDAIDGKQARRTNSCSPLGELFDHGCDSLSTVFMAVGASIAARLGTYPDWFFFCSFIGMFVFYCAHWQTYVSGMLRFGKVDVTEIQIALVIVFVLSAFGGATMWDYTIPILEIKLKILPVLGFLGGVIFSCSNYFHVILHGGVGKNGSTIAGTSVLSPGLHIGLIIILAIMIYKKSATDVFEKHPCLYILMFGCVFAKVSQKLVVAHMTKSELYLQDTVFLGPGLLFLDQYFNNFIDEYVVLWMAMVISSFDMVIYFSALCLQISRHLHLNIFKTACHQAPEQVQVLSSKSHQNNMD | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000139 | TAS:Reactome | C | Golgi membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0043231 | NAS:UniProtKB | C | intracellular membrane-bounded organelle |
| GO:0016020 | NAS:UniProtKB | C | membrane |
| GO:0019992 | NAS:UniProtKB | F | diacylglycerol binding |
| GO:0004142 | IDA:UniProtKB | F | diacylglycerol cholinephosphotransferase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0006657 | NAS:UniProtKB | P | CDP-choline pathway |
| GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
| GO:0006629 | TAS:ProtInc | P | lipid metabolic process |
| GO:0006656 | IDA:UniProtKB | P | phosphatidylcholine biosynthetic process |
| GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
| GO:0006663 | IDA:UniProtKB | P | platelet activating factor biosynthetic process |
| GO:0001558 | NAS:UniProtKB | P | regulation of cell growth |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121238 | Synthesis of PC |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=Alpha; IsoId=Q8WUD6-1; Sequence=Displayed; Name=2; Synonyms=Beta; IsoId=Q8WUD6-2; Sequence=VSP_025989, VSP_025990; |
| Catalytic Activity | CDP-choline + 1,2-diacyl-sn-glycerol = CMP + a phosphatidylcholine. |
| Cofactor | Name=Mg(2+); Xref=ChEBI |
| Function | Catalyzes phosphatidylcholine biosynthesis from CDP- choline. It thereby plays a central role in the formation and maintenance of vesicular membranes. |
| Pathway | Phospholipid metabolism; phosphatidylcholine biosynthesis; phosphatidylcholine from phosphocholine: step 2/2. |
| Sequence Caution | Sequence=AAD44019.1; Type=Frameshift; Positions=310; Evidence= ; Sequence=AAL39005.1; Type=Erroneous initiation; Evidence= ; |
| Similarity | Belongs to the CDP-alcohol phosphatidyltransferase class-I family. |
| Subcellular Location | Golgi apparatus membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Highly expressed in testis, colon, small intestine, heart, prostate and spleen. Also detected in kidney, skeletal muscle, pancreas, leukocytes, ovary and thymus. Weakly expressed in the brain, placenta and lung. Overexpressed in cancerous breast epithelial cell lines. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006641 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 50726996 | RefSeq | NP_064629 | 406 | cholinephosphotransferase 1 |
Identical Sequences to LMP006641 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50726996 | DBBJ | BAG52084.1 | 406 | unnamed protein product [Homo sapiens] |
| GI:50726996 | EMBL | CAF86967.1 | 406 | unnamed protein product [Homo sapiens] |
| GI:50726996 | GenBank | EAW97675.1 | 406 | choline phosphotransferase 1, isoform CRA_c [Homo sapiens] |
| GI:50726996 | GenBank | ACW21192.1 | 406 | Sequence 83 from patent US 7560233 |
| GI:50726996 | GenBank | AIC51956.1 | 406 | CHPT1, partial [synthetic construct] |
| GI:50726996 | SwissProt | Q8WUD6.1 | 406 | RecName: Full=Cholinephosphotransferase 1; Short=hCPT1; AltName: Full=AAPT1-like protein; AltName: Full=Diacylglycerol cholinephosphotransferase 1 [Homo sapiens] |
Related Sequences to LMP006641 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50726996 | GenBank | AAF87947.1 | 406 | cholinephosphotransferase 1 alpha [Homo sapiens] |
| GI:50726996 | GenBank | AAN90144.1 | 406 | Sequence 4 from patent US 6451568 |
| GI:50726996 | GenBank | JAA17378.1 | 406 | choline phosphotransferase 1 [Pan troglodytes] |
| GI:50726996 | GenBank | JAA27441.1 | 406 | choline phosphotransferase 1 [Pan troglodytes] |
| GI:50726996 | GenBank | JAA40375.1 | 406 | choline phosphotransferase 1 [Pan troglodytes] |
| GI:50726996 | RefSeq | XP_001154659.1 | 406 | PREDICTED: cholinephosphotransferase 1 isoform X1 [Pan troglodytes] |