Gene/Proteome Database (LMPD)
LMPD ID
LMP006583
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phosphatidylinositol 4-kinase type 2 beta
Gene Symbol
Synonyms
2610042N09Rik; 4933409G22Rik
Alternate Names
phosphatidylinositol 4-kinase type 2-beta; phosphatidylinositol 4-kinase type II-beta
Chromosome
5
Map Location
5 C1|5
EC Number
2.7.1.67
Proteins
| phosphatidylinositol 4-kinase type 2-beta isoform 1 | |
|---|---|
| Refseq ID | NP_080227 |
| Protein GI | 145966899 |
| UniProt ID | Q8CBQ5 |
| mRNA ID | NM_025951 |
| Length | 469 |
| RefSeq Status | VALIDATED |
| MAEACEPTRPSEDEDEEREPLLPRVAWAQPRRVAPGSAVRMQADEGADVLREPATDEPPAVSGEGSISASLSTELDRTRTTSSETNTFLEDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLLPNQGYLSEAGAYLVDVKLNLGIVPKTKVVWLVSETFNYSAIDRAKSRGKKYALEKVPKVGRKFHRIGLPPKVGSFQLFVKDYKEAEYWLRRFEAEPLPENIRKQFQSQFEKLVILDYIIRNTDRGNDNWLVKYDEMKYAKKIESEESNWIDNKQLLIKIAAIDNGLAFPFKHPDEWRAYPFHWAWLPQAKVPFSEETRNLILPYISDMNFVQDLCEDLYELFKTDKGFDRAAFENQMSVMRGQILNLTQALRDGKSPMQLAQMPCVIVECSKSGSQGRVVHLGSSFTQTVHCRKPFFSSW | |
| phosphatidylinositol 4-kinase type 2-beta isoform 2 | |
|---|---|
| Refseq ID | NP_083020 |
| Protein GI | 145966816 |
| UniProt ID | Q8CBQ5 |
| mRNA ID | NM_028744 |
| Length | 446 |
| RefSeq Status | VALIDATED |
| MAEACEPTRPSEDEDEEREPLLPRVAWAQPRRVAPGSAVRMQADEGADVLREPATDEPPAVSGEGSISASLSTELDRTRTTSSGPELCPFYSRSLCYKTTTALGYYNIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLLPNQGYLSEAGAYLVDVKLNLGIVPKTKVVWLVSETFNYSAIDRAKSRGKKYALEKVPKVGRKFHRIGLPPKVGSFQLFVKDYKEAEYWLRRFEAEPLPENIRKQFQSQFEKLVILDYIIRNTDRGNDNWLVKYDEMKYAKKIESEESNWIDNKQLLIKIAAIDNGLAFPFKHPDEWRAYPFHWAWLPQAKVPFSEETRNLILPYISDMNFVQDLCEDLYELFKTDKGFDRAAFENQMSVMRGQILNLTQALRDGKSPMQLAQMPCVIVECSKSGSQGRVVHLGSSFTQTVHCRKPFFSSW | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol 4-kinase type 2 beta
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0016020 | IEA:UniProtKB-KW | C | membrane |
| GO:0004430 | IEA:UniProtKB-EC | F | 1-phosphatidylinositol 4-kinase activity |
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu00562 | Inositol phosphate metabolism |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000403 | Phosphatidylinositol 3-/4-kinase, catalytic domain |
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol 4-kinase type 2 beta
Protein Entry
P4K2B_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8CBQ5-1; Sequence=Displayed; Name=2; IsoId=Q8CBQ5-2; Sequence=VSP_024828; |
| Catalytic Activity | ATP + 1-phosphatidyl-1D-myo-inositol = ADP + 1-phosphatidyl-1D-myo-inositol 4-phosphate. |
| Enzyme Regulation | Recruited and activated by membrane association. Binding to the microsomal membrane has been shown to enhance its activity (By similarity). {ECO:0000250}. |
| Function | Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily. {ECO:0000305}. |
| Similarity | Contains 1 PI3K/PI4K domain. {ECO:0000305}. |
| Subcellular Location | Cytoplasm {ECO:0000250}. Membrane {ECO:0000250}. Note=Mostly cytoplasmic but also found associated with the plasma membrane, the Golgi and endosomes. Compared to PI4K2A, a larger fraction of PI4K2B is cytosolic due to a smaller extent of palmitoylation. Translocates to membranes where it is recruited by PDGF stimulation by a Rac-GTP-dependent mechanism (By similarity). {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006583 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 145966899 | RefSeq | NP_080227 | 469 | phosphatidylinositol 4-kinase type 2-beta isoform 1 |
| 145966816 | RefSeq | NP_083020 | 446 | phosphatidylinositol 4-kinase type 2-beta isoform 2 |
Identical Sequences to LMP006583 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145966899 | DBBJ | BAC29091.1 | 469 | unnamed protein product [Mus musculus] |
| GI:145966899 | DBBJ | BAE41986.1 | 469 | unnamed protein product [Mus musculus] |
| GI:145966899 | GenBank | AAH62144.1 | 469 | Phosphatidylinositol 4-kinase type 2 beta [Mus musculus] |
| GI:145966899 | SwissProt | Q8CBQ5.1 | 469 | RecName: Full=Phosphatidylinositol 4-kinase type 2-beta; AltName: Full=Phosphatidylinositol 4-kinase type II-beta [Mus musculus] |
Related Sequences to LMP006583 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145966899 | DBBJ | BAB27819.1 | 469 | unnamed protein product [Mus musculus] |
| GI:145966816 | DBBJ | BAB30411.1 | 445 | unnamed protein product [Mus musculus] |
| GI:145966816 | DBBJ | BAC29091.1 | 469 | unnamed protein product [Mus musculus] |
| GI:145966899 | GenBank | AAL04155.1 | 469 | type II phosphatidylinositol 4-kinase beta isoform [Mus musculus] |
| GI:145966816 | GenBank | AAN37399.1 | 445 | phosphatidylinositol 4-kinase type 2 beta [Mus musculus] |
| GI:145966816 | GenBank | AAH62144.1 | 469 | Phosphatidylinositol 4-kinase type 2 beta [Mus musculus] |
| GI:145966899 | GenBank | AAH83668.1 | 477 | Phosphatidylinositol 4-kinase type 2 beta [Rattus norvegicus] |
| GI:145966899 | GenBank | EDL37661.1 | 469 | phosphatidylinositol 4-kinase type 2 beta, isoform CRA_a [Mus musculus] |
| GI:145966816 | GenBank | EDL37662.1 | 446 | phosphatidylinositol 4-kinase type 2 beta, isoform CRA_b [Mus musculus] |
| GI:145966899 | RefSeq | NP_001005883.1 | 477 | phosphatidylinositol 4-kinase type 2-beta [Rattus norvegicus] |
| GI:145966816 | SwissProt | Q8CBQ5.1 | 469 | RecName: Full=Phosphatidylinositol 4-kinase type 2-beta; AltName: Full=Phosphatidylinositol 4-kinase type II-beta [Mus musculus] |
| GI:145966899 | SwissProt | Q5XIL2.1 | 477 | RecName: Full=Phosphatidylinositol 4-kinase type 2-beta; AltName: Full=Phosphatidylinositol 4-kinase type II-beta [Rattus norvegicus] |