Gene/Proteome Database (LMPD)

LMPD ID
LMP006194
Gene ID
12802
Species
Mus musculus (Mouse)
Gene Name
cannabinoid receptor 2 (macrophage)
Gene Symbol
Cnr2
Synonyms
CB-2; CB2; CB2-R
Alternate Names
cannabinoid receptor 2; cannabinoid receptor 2 (spleen)
Chromosome
4
Map Location
4 D3|4

Proteins

cannabinoid receptor 2
Refseq ID NP_034054
Protein GI 157012011
UniProt ID P47936
mRNA ID NM_009924
Length 347
RefSeq Status VALIDATED
MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILSSRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTASVGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLDVRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYALRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT

Gene Information

Entrez Gene ID
12802
Gene Name
cannabinoid receptor 2 (macrophage)
Gene Symbol
Cnr2
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030425 IEA:Ensembl C dendrite
GO:0031234 IEA:Ensembl C extrinsic component of cytoplasmic side of plasma membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043025 IEA:Ensembl C neuronal cell body
GO:0004949 IEA:Ensembl F cannabinoid receptor activity
GO:0006954 IEA:UniProtKB-KW P inflammatory response
GO:0045759 IEA:Ensembl P negative regulation of action potential
GO:0050728 IEA:Ensembl P negative regulation of inflammatory response
GO:0033004 IEA:Ensembl P negative regulation of mast cell activation
GO:0051001 IEA:Ensembl P negative regulation of nitric-oxide synthase activity
GO:0032229 IEA:Ensembl P negative regulation of synaptic transmission, GABAergic
GO:0001975 IEA:Ensembl P response to amphetamine
GO:0032496 IEA:Ensembl P response to lipopolysaccharide
GO:0019233 IEA:Ensembl P sensory perception of pain

REACTOME Pathway Links

REACTOME Pathway ID Description
5893663 G alpha (i) signalling events

Domain Information

InterPro Annotations

Accession Description
IPR002230 Cannabinoid receptor family
IPR001551 Cannabinoid receptor type 2
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
cannabinoid receptor 2 (macrophage)
Protein Entry
CNR2_MOUSE
UniProt ID
P47936
Species
Mouse

Comments

Comment Type Description
Disruption Phenotype Mutant mice are responsive to the psychotropic effects of cannabinoid but not to the cannabinoid- induced immunomodulation. They also show accelerated age-related trabecular bone loss and cortical expansion. {ECO:0000269|PubMed:10822068}.
Function Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis. {ECO:0000269|PubMed:10822068, ECO:0000269|PubMed:11929767, ECO:0000269|PubMed:16407142, ECO:0000269|PubMed:16563625, ECO:0000269|PubMed:16924491, ECO:0000269|PubMed:17401376, ECO:0000269|PubMed:18286196, ECO:0000269|PubMed:8679694}.
Similarity Belongs to the G-protein coupled receptor 1 family. {ECO:0000255|PROSITE-ProRule:PRU00521}.
Subcellular Location Cell membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Cell projection, dendrite {ECO:0000250}. Perikaryon {ECO:0000250}. Note=Localizes to apical dendrite of pyramidal neurons. {ECO:0000250}.
Tissue Specificity Expressed by cells of hematopoietic origin. Expressed in skin in suprabasal layers and hair follicles, in brain by neurons and glial cells and by osteoblasts, osteocytes, osteoclasts (at protein level). {ECO:0000269|PubMed:11929767, ECO:0000269|PubMed:12511587, ECO:0000269|PubMed:16407142, ECO:0000269|PubMed:16924491, ECO:0000269|PubMed:18286196}.

Identical and Related Proteins

Unique RefSeq proteins for LMP006194 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157012011 RefSeq NP_034054 347 cannabinoid receptor 2

Identical Sequences to LMP006194 proteins

Reference Database Accession Length Protein Name
GI:157012011 DBBJ BAC29520.1 347 unnamed protein product [Mus musculus]
GI:157012011 DBBJ BAC29894.1 347 unnamed protein product [Mus musculus]
GI:157012011 DBBJ BAE22017.1 347 unnamed protein product [Mus musculus]
GI:157012011 GenBank AAH24052.1 347 Cnr2 protein [Mus musculus]
GI:157012011 GenBank EDL29965.1 347 cannabinoid receptor 2 (macrophage) [Mus musculus]
GI:157012011 RefSeq XP_006538578.1 347 PREDICTED: cannabinoid receptor 2 isoform X1 [Mus musculus]

Related Sequences to LMP006194 proteins

Reference Database Accession Length Protein Name
GI:157012011 EMBL CAA63655.1 347 Cannabinoid receptor-2 [Mus musculus]
GI:157012011 GenBank AAA63757.1 347 CB2 cannabionid receptor [Mus musculus]
GI:157012011 GenBank ACS88355.1 360 CB2B isoform [Rattus norvegicus]
GI:157012011 GenBank ACS88356.1 360 CB2A isoform [Rattus norvegicus]
GI:157012011 GenBank AFN80333.1 360 CB2 receptor isoform C [Rattus norvegicus]
GI:157012011 SwissProt Q9QZN9.3 360 RecName: Full=Cannabinoid receptor 2; Short=CB-2; Short=CB2; Short=rCB2 [Rattus norvegicus]