Gene/Proteome Database (LMPD)

LMPD ID
LMP006053
Gene ID
Species
Homo sapiens (Human)
Gene Name
zinc finger, DHHC-type containing 9
Gene Symbol
Synonyms
CGI89; CXorf11; DHHC9; MMSA1; MRXSZ; ZDHHC10; ZNF379; ZNF380
Alternate Names
palmitoyltransferase ZDHHC9; antigen MMSA-1; zinc finger protein 379; zinc finger protein 380; zinc finger, DHHC domain containing 10; Asp-His-His-Cys domain containing protein 9
Chromosome
X
Map Location
Xq26.1
EC Number
2.3.1.225
Summary
This gene encodes an integral membrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein forms a complex with golgin subfamily A member 7 and functions as a palmitoyltransferase. This protein specifically palmitoylates HRAS and NRAS. Mutations in this gene are associated with X-linked mental retardation. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, May 2010]
Orthologs

Proteins

palmitoyltransferase ZDHHC9
Refseq ID NP_057116
Protein GI 56682972
UniProt ID Q9Y397
mRNA ID NM_016032
Length 364
RefSeq Status REVIEWED
MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPPEPPEPPQEAAEAEK
palmitoyltransferase ZDHHC9
Refseq ID NP_001008223
Protein GI 56682974
UniProt ID Q9Y397
mRNA ID NM_001008222
Length 364
RefSeq Status REVIEWED
Protein sequence is identical to GI:56682972 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 9
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:UniProt C Golgi apparatus
GO:0005737 IDA:HPA C cytoplasm
GO:0005783 IDA:UniProt C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0031228 IDA:UniProt C intrinsic component of Golgi membrane
GO:0002178 IDA:UniProt C palmitoyltransferase complex
GO:0043849 IDA:UniProt F Ras palmitoyltransferase activity
GO:0016409 IDA:UniProt F palmitoyltransferase activity
GO:0019706 IEA:UniProtKB-EC F protein-cysteine S-palmitoyltransferase activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0018230 IDA:UniProt P peptidyl-L-cysteine S-palmitoylation
GO:0018345 IDA:UniProt P protein palmitoylation

Domain Information

InterPro Annotations

Accession Description
IPR001594 Zinc finger, DHHC-type, palmitoyltransferase

UniProt Annotations

Entry Information

Gene Name
zinc finger, DHHC-type containing 9
Protein Entry
ZDHC9_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Catalytic Activity Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
Disease Mental retardation, X-linked, syndromic, ZDHHC9-related (MRXSZ) [MIM
Domain The DHHC domain is required for palmitoyltransferase activity.
Function The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
Sequence Caution Sequence=AAD34084.1; Type=Erroneous initiation; Evidence= ; Sequence=BAA91683.1; Type=Erroneous initiation; Evidence= ; Sequence=BAD93044.1; Type=Erroneous initiation; Evidence= ; Sequence=CAB82308.1; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the DHHC palmitoyltransferase family. ERF2/ZDHHC9 subfamily.
Similarity Contains 1 DHHC-type zinc finger.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein . Golgi apparatus membrane ; Multi-pass membrane protein .
Subunit Interacts with GOLGA7.
Tissue Specificity Highly expressed in kidney, skeletal muscle, brain, lung and liver. Absent in thymus, spleen and leukocytes.

Identical and Related Proteins

Unique RefSeq proteins for LMP006053 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
56682972 RefSeq NP_057116 364 palmitoyltransferase ZDHHC9

Identical Sequences to LMP006053 proteins

Reference Database Accession Length Protein Name
GI:56682972 GenBank JAB38345.1 364 palmitoyltransferase ZDHHC9 [Callithrix jacchus]
GI:56682972 GenBank JAB45476.1 364 palmitoyltransferase ZDHHC9 [Callithrix jacchus]
GI:56682972 GenBank AHD76044.1 364 Sequence 18427 from patent US 8586006
GI:56682972 GenBank AHD76045.1 364 Sequence 18428 from patent US 8586006
GI:56682972 GenBank AIC51404.1 364 ZDHHC9, partial [synthetic construct]
GI:56682972 RefSeq XP_008970593.1 364 PREDICTED: palmitoyltransferase ZDHHC9 isoform X1 [Pan paniscus]

Related Sequences to LMP006053 proteins

Reference Database Accession Length Protein Name
GI:56682972 DBBJ BAD93044.1 389 zinc finger, DHHC domain containing 9 variant, partial [Homo sapiens]
GI:56682972 EMBL CAB82308.1 381 hypothetical protein, partial [Homo sapiens]
GI:56682972 GenBank EHH61213.1 364 Palmitoyltransferase ZDHHC9 [Macaca fascicularis]
GI:56682972 PIR - 381 hypothetical protein DKFZp761E1347.1 - human (fragment) [Homo sapiens]
GI:56682972 RefSeq XP_003918308.1 364 PREDICTED: palmitoyltransferase ZDHHC9 [Papio anubis]
GI:56682972 RefSeq XP_010353095.1 364 PREDICTED: palmitoyltransferase ZDHHC9 [Rhinopithecus roxellana]