Gene/Proteome Database (LMPD)

LMPD ID
LMP005986
Gene ID
71707
Species
Mus musculus (Mouse)
Gene Name
UbiA prenyltransferase domain containing 1
Gene Symbol
Ubiad1
Synonyms
1200002M06Rik; AI426463; AW320947; Tere1
Alternate Names
ubiA prenyltransferase domain-containing protein 1; transitional epithelia response protein
Chromosome
4
Map Location
4|4 E1
EC Number
2.5.1.-

Proteins

ubiA prenyltransferase domain-containing protein 1
Refseq ID NP_082149
Protein GI 21311819
UniProt ID Q9DC60
mRNA ID NM_027873
Length 336
RefSeq Status PROVISIONAL
MAAVQAPGEKINILAGETAKVGDPQKNEWPEQDRLPERSWRHKCASYVLALRPWSFSASLTPVALGSALAYRSQGVLDPRLLLGCAVAVLAVHGAGNLVNTYYDFSKGIDHKKSDDRTLVDRILEPQDVVRFGVFLYTLGCVCAACLYYLSALKLEHLALIYFGGLSGSFLYTGGIGFKYVALGDLVILITFGPLAVMFAYAVQVGSLAIFPLIYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTFSYVLYNTLLFVPYLIFTILATHCSISLALPLLTIPMAFSLERQFRSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPRL

Gene Information

Entrez Gene ID
71707
Gene Name
UbiA prenyltransferase domain containing 1
Gene Symbol
Ubiad1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 ISS:UniProtKB C endoplasmic reticulum
GO:0030173 ISS:UniProtKB C integral component of Golgi membrane
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0005634 IEA:Ensembl C nucleus
GO:0016209 ISS:UniProtKB F antioxidant activity
GO:0004659 ISS:UniProtKB F prenyltransferase activity
GO:0072358 ISS:UniProtKB P cardiovascular system development
GO:0001885 ISS:UniProtKB P endothelial cell development
GO:0009234 ISS:UniProtKB P menaquinone biosynthetic process
GO:0006744 ISS:UniProtKB P ubiquinone biosynthetic process
GO:0042371 ISS:UniProtKB P vitamin K biosynthetic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5870 ubiquinol-8 biosynthesis (eukaryotic)

Domain Information

InterPro Annotations

Accession Description
IPR026046 UbiA prenyltransferase domain containing protein 1
IPR000537 UbiA prenyltransferase family

UniProt Annotations

Entry Information

Gene Name
UbiA prenyltransferase domain containing 1
Protein Entry
UBIA1_MOUSE
UniProt ID
Q9DC60
Species
Mouse

Comments

Comment Type Description
Function Prenyltransferase that mediates the formation of menaquinone-4 (MK-4) and coenzyme Q10. MK-4 is a vitamin K2 isoform required for endothelial cell development. Mediates the conversion of phylloquinone (PK) into MK-4, probably by cleaving the side chain of phylloquinone (PK) to release 2-methyl-1,4- naphthoquinone (menadione; K3) and then prenylating it with geranylgeranyl pyrophosphate (GGPP) to form MK-4. Also plays a role in cardiovascular development independently of MK-4 biosynthesis, by acting as a coenzyme Q10 biosyntetic enzyme: coenzyme Q10, also named ubiquinone, plays a important antioxidant role in the cardiovascular system. Mediates biosynthesis of coenzyme Q10 in the Golgi membrane, leading to protect cardiovascular tissues from NOS3/eNOS-dependent oxidative stress (By similarity). {ECO:0000250}.
Pathway Cofactor biosynthesis; ubiquinone biosynthesis.
Pathway Quinol/quinone metabolism; menaquinone biosynthesis.
Similarity Belongs to the UbiA prenyltransferase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Golgi apparatus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Mitochondrion {ECO:0000250}.
Subunit Interacts with HMGCR and SOAT1. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP005986 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21311819 RefSeq NP_082149 336 ubiA prenyltransferase domain-containing protein 1

Identical Sequences to LMP005986 proteins

Reference Database Accession Length Protein Name
GI:21311819 DBBJ BAB23364.1 336 unnamed protein product [Mus musculus]
GI:21311819 DBBJ BAC37276.2 336 unnamed protein product [Mus musculus]
GI:21311819 GenBank AAH15303.1 336 UbiA prenyltransferase domain containing 1 [Mus musculus]
GI:21311819 GenBank AGC99287.1 336 Sequence 26 from patent US 8334369
GI:21311819 SwissProt Q9DC60.1 336 RecName: Full=UbiA prenyltransferase domain-containing protein 1 [Mus musculus]

Related Sequences to LMP005986 proteins

Reference Database Accession Length Protein Name
GI:21311819 GenBank AAH71203.1 336 UbiA prenyltransferase domain containing 1 [Mus musculus]
GI:21311819 GenBank EDL14817.1 336 UbiA prenyltransferase domain containing 1, isoform CRA_a [Mus musculus]
GI:21311819 GenBank EGW12896.1 338 UbiA prenyltransferase domain-containing protein 1 [Cricetulus griseus]
GI:21311819 GenBank ERE84040.1 338 ubiA prenyltransferase domain-containing protein 1 [Cricetulus griseus]
GI:21311819 RefSeq XP_003513224.1 338 PREDICTED: ubiA prenyltransferase domain-containing protein 1 [Cricetulus griseus]
GI:21311819 RefSeq XP_007623594.1 338 PREDICTED: ubiA prenyltransferase domain-containing protein 1 [Cricetulus griseus]