Gene/Proteome Database (LMPD)
Proteins
| plasmolipin | |
|---|---|
| Refseq ID | NP_057077 |
| Protein GI | 7705755 |
| UniProt ID | Q9Y342 |
| mRNA ID | NM_015993 |
| Length | 182 |
| RefSeq Status | VALIDATED |
| MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRSRLGALMLLQLVLGLLVWALIADTPYHLYPAYGWVMFVAVFLWLVTIVLFNLYLFQLHMKLYMVPWPLVLMIFNISATVLYITAFIACSAAVDLTSLRGTRPYNQRAAASFFACLVMIAYGVSAFFSYQAWRGVGSNAATSQMAGGYA | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0043218 | IEA:Ensembl | C | compact myelin |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0045121 | IEA:Ensembl | C | membrane raft |
| GO:0006811 | IEA:UniProtKB-KW | P | ion transport |
| GO:0042552 | IEA:Ensembl | P | myelination |
| GO:0009611 | IEA:Ensembl | P | response to wounding |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Appears to be involved in myelination. Could also participate in ion transport events as addition of plasmolipin to lipid bilayers induces the formation of ion channels, which are voltage-dependent and K(+)-selective (By similarity). |
| Similarity | Belongs to the MAL family. |
| Similarity | Contains 1 MARVEL domain. {ECO |
| Subcellular Location | Membrane; Multi-pass membrane protein. |
| Subunit | Hexamer arranged as a trimer of two plasmolipin subunits. |
Identical and Related Proteins
Unique RefSeq proteins for LMP005897 (as displayed in Record Overview)
Identical Sequences to LMP005897 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7705755 | DBBJ | BAG36633.1 | 182 | unnamed protein product [Homo sapiens] |
| GI:7705755 | GenBank | EAW82915.1 | 182 | plasma membrane proteolipid (plasmolipin), isoform CRA_a [Homo sapiens] |
| GI:7705755 | GenBank | EAW82917.1 | 182 | plasma membrane proteolipid (plasmolipin), isoform CRA_a [Homo sapiens] |
| GI:7705755 | GenBank | ACQ12347.1 | 182 | Sequence 30 from patent US 7507536 |
| GI:7705755 | GenBank | ADQ32856.1 | 182 | plasma membrane proteolipid (plasmolipin), partial [synthetic construct] |
| GI:7705755 | GenBank | AIC51392.1 | 182 | PLLP, partial [synthetic construct] |
Related Sequences to LMP005897 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7705755 | DBBJ | BAF82288.1 | 182 | unnamed protein product [Homo sapiens] |
| GI:7705755 | RefSeq | XP_001145227.1 | 182 | PREDICTED: plasmolipin [Pan troglodytes] |
| GI:7705755 | RefSeq | XP_002826507.1 | 182 | PREDICTED: plasmolipin [Pongo abelii] |
| GI:7705755 | RefSeq | XP_003263143.1 | 182 | PREDICTED: plasmolipin [Nomascus leucogenys] |
| GI:7705755 | RefSeq | XP_004057746.1 | 182 | PREDICTED: plasmolipin [Gorilla gorilla gorilla] |
| GI:7705755 | RefSeq | XP_008975663.1 | 182 | PREDICTED: plasmolipin [Pan paniscus] |