Gene/Proteome Database (LMPD)
LMPD ID
LMP005576
Gene ID
Species
Mus musculus (Mouse)
Gene Name
serum/glucocorticoid regulated kinase 3
Gene Symbol
Synonyms
2510015P22Rik; A330005P07Rik; Cisk; fy; fz
Alternate Names
serine/threonine-protein kinase Sgk3; cytokine-independent survival kinase; serum/glucocorticoid-regulated kinase 3
Chromosome
1
Map Location
1 A2|1 2.08 cM
EC Number
2.7.11.1
Proteins
| serine/threonine-protein kinase Sgk3 | |
|---|---|
| Refseq ID | NP_573483 |
| Protein GI | 18959280 |
| UniProt ID | Q9ERE3 |
| mRNA ID | NM_133220 |
| Length | 496 |
| RefSeq Status | VALIDATED |
| MQRDCIMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNSLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPRHQSDPSEDEDERSTSKPHSTSRNINLGPTGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSMGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLNLRPGVSLTAWSILEELLEKNRQNRLGAKEDFLEIQNHPFFESLSWTDLVQKKIPPPFNPNVAGPDDIRNFDAVFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFL | |
| serine/threonine-protein kinase Sgk3 | |
|---|---|
| Refseq ID | NP_001032848 |
| Protein GI | 83649757 |
| UniProt ID | Q9ERE3 |
| mRNA ID | NM_001037759 |
| Length | 496 |
| RefSeq Status | VALIDATED |
| Protein sequence is identical to GI:18959280 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
serum/glucocorticoid regulated kinase 3
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016023 | IDA:MGI | C | cytoplasmic membrane-bounded vesicle |
| GO:0005768 | IEA:UniProtKB-KW | C | endosome |
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
| GO:0035091 | IEA:InterPro | F | phosphatidylinositol binding |
| GO:0004674 | IDA:MGI | F | protein serine/threonine kinase activity |
| GO:2001240 | IDA:MGI | P | negative regulation of extrinsic apoptotic signaling pathway in absence of ligand |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu04068 | FoxO signaling pathway |
| ko04151 | PI3K-Akt signaling pathway |
| mmu04151 | PI3K-Akt signaling pathway |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5894103 | Stimuli-sensing channels |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000961 | AGC-kinase, C-terminal |
| IPR001683 | Phox homologous domain |
| IPR000719 | Protein kinase domain |
| IPR017441 | Protein kinase, ATP binding site |
| IPR017892 | Protein kinase, C-terminal |
| IPR011009 | Protein kinase-like domain |
| IPR008271 | Serine/threonine-protein kinase, active site |
| IPR002290 | Serine/threonine/dual specificity protein kinase, catalytic domain |
UniProt Annotations
Entry Information
Gene Name
serum/glucocorticoid regulated kinase 3
Protein Entry
SGK3_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | ATP + a protein = ADP + a phosphoprotein. |
| Enzyme Regulation | Two specific sites, one in the kinase domain (Thr-320) and the other in the C-terminal regulatory region (Ser- 486), need to be phosphorylated for its full activation. |
| Function | Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, proliferation, survival and migration. Up-regulates Na(+) channels: SCNN1A/ENAC and SCN5A, K(+) channels: KCNA3/KV1.3, KCNE1, KCNQ1 and KCNH2/HERG, epithelial Ca(2+) channels: TRPV5 and TRPV6, chloride channel: BSND, creatine transporter: SLC6A8, Na(+)/dicarboxylate cotransporter: SLC13A2/NADC1, Na(+)-dependent phosphate cotransporter: SLC34A2/NAPI-2B, amino acid transporters: SLC1A5/ASCT2 and SLC6A19, glutamate transporters: SLC1A3/EAAT1, SLC1A6/EAAT4 and SLC1A7/EAAT5, glutamate receptors: GRIA1/GLUR1 and GRIK2/GLUR6, Na(+)/H(+) exchanger: SLC9A3/NHE3, and the Na(+)/K(+) ATPase. Plays a role in the regulation of renal tubular phosphate transport and bone density. Phosphorylates NEDD4L and GSK3B. Positively regulates ER transcription activity through phosphorylation of FLII. Negatively regulates the function of ITCH/AIP4 via its phosphorylation and thereby prevents CXCR4 from being efficiently sorted to lysosomes. {ECO:0000269|PubMed:15774535, ECO:0000269|PubMed:15774536, ECO:0000269|PubMed:21113728, ECO:0000269|PubMed:21451460, ECO:0000269|PubMed:21865597}. |
| Ptm | Activated by phosphorylation on Ser-486 by an unknown kinase (may be mTORC2 but not confirmed), transforming it into a substrate for PDPK1 which then phosphorylates it on Thr-320. {ECO:0000250}. |
| Similarity | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. {ECO:0000305}. |
| Similarity | Contains 1 AGC-kinase C-terminal domain. {ECO:0000305}. |
| Similarity | Contains 1 PX (phox homology) domain. {ECO:0000255|PROSITE-ProRule:PRU00147}. |
| Similarity | Contains 1 protein kinase domain. {ECO:0000255|PROSITE-ProRule:PRU00159}. |
| Subcellular Location | Cytoplasmic vesicle {ECO:0000269|PubMed:21865597}. Early endosome {ECO:0000269|PubMed:21865597}. Recycling endosome {ECO:0000250}. Note=Endosomal localization is a prerequisite for complete kinase activity. It is essential for its colocalization with the kinase responsible for phosphorylating Ser-486 thus allowing PDPK1 phosphorylation of Thr-320 resulting in complete activation of SGK3. Colocalizes with SLC9A3/NHE3 in the recycling endosomes (By similarity). Localized in vesicle-like structures and in the early endosome. {ECO:0000250}. |
| Subunit | Interacts with GSK3B and FLII. Interacts with PDPK1 in a phosphorylation-dependent manner. {ECO:0000250}. |
| Tissue Specificity | Widely expressed, predominantly in the heart, spleen and 7-day embryo. |
Identical and Related Proteins
Unique RefSeq proteins for LMP005576 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18959280 | RefSeq | NP_573483 | 496 | serine/threonine-protein kinase Sgk3 |
Identical Sequences to LMP005576 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18959280 | DBBJ | BAE42262.1 | 496 | unnamed protein product [Mus musculus] |
| GI:18959280 | DBBJ | BAE42298.1 | 496 | unnamed protein product [Mus musculus] |
| GI:18959280 | GenBank | ABK42426.1 | 496 | Sgk3 [synthetic construct] |
| GI:18959280 | GenBank | EDL14292.1 | 496 | mCG131353, isoform CRA_a [Mus musculus] |
| GI:18959280 | RefSeq | NP_808215.2 | 496 | serine/threonine-protein kinase Sgk3 [Mus musculus] |
| GI:18959280 | RefSeq | NP_001032848.1 | 496 | serine/threonine-protein kinase Sgk3 [Mus musculus] |
Related Sequences to LMP005576 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18959280 | DBBJ | BAC27349.1 | 496 | unnamed protein product [Mus musculus] |
| GI:18959280 | DBBJ | BAE30755.1 | 496 | unnamed protein product [Mus musculus] |
| GI:18959280 | RefSeq | XP_003754029.1 | 496 | PREDICTED: serine/threonine-protein kinase Sgk3 isoform X1 [Rattus norvegicus] |
| GI:18959280 | RefSeq | XP_007634262.1 | 496 | PREDICTED: serine/threonine-protein kinase Sgk3 isoform X2 [Cricetulus griseus] |
| GI:18959280 | RefSeq | XP_007634263.1 | 496 | PREDICTED: serine/threonine-protein kinase Sgk3 isoform X2 [Cricetulus griseus] |
| GI:18959280 | SwissProt | Q8R4V0.2 | 496 | RecName: Full=Serine/threonine-protein kinase Sgk3; AltName: Full=Cytokine-independent survival kinase; AltName: Full=Serum/glucocorticoid-regulated kinase 3; AltName: Full=Serum/glucocorticoid-regulated kinase-like [Rattus norvegicus] |