Gene/Proteome Database (LMPD)

LMPD ID
LMP005479
Gene ID
Species
Mus musculus (Mouse)
Gene Name
glutathione peroxidase 5
Gene Symbol
Synonyms
AV379049; Arep
Alternate Names
epididymal secretory glutathione peroxidase; EGLP; GPx-5; GSHPx-5; arMEP24; major androgen-regulated protein; lysosomal trafficking regulator, long splice form; epididymis-specific glutathione peroxidase-like protein
Chromosome
13
Map Location
13 A2-A4|13 7.73 cM
EC Number
1.11.1.9

Proteins

epididymal secretory glutathione peroxidase precursor
Refseq ID NP_034473
Protein GI 171543846
UniProt ID P21765
mRNA ID NM_010343
Length 221
RefSeq Status VALIDATED
MVTELRVFYLVPLLLASYVQTTPRPEKMKMDCYKDVKGTIYDYEALSLNGKEHIPFKQYAGKHVLFVNVATYCGLTIQYPELNALQEDLKPFGLVILGFPCNQFGKQEPGDNLEILPGLKYVRPGKGFLPNFQLFAKGDVNGENEQKIFTFLKRSCPHPSETVVMSKHTFWEPIKVHDIRWNFEKFLVGPDGIPVMRWFHQAPVSTVKSDIMAYLSHFKTI
sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2456 peptide sequence: MVTELRVFYLVPLLLASYVQT mat_peptide: 22..221 product: Epididymal secretory glutathione peroxidase experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P21765.3) calculated_mol_wt: 22955 peptide sequence: TPRPEKMKMDCYKDVKGTIYDYEALSLNGKEHIPFKQYAGKHVLFVNVATYCGLTIQYPELNALQEDLKPFGLVILGFPCNQFGKQEPGDNLEILPGLKYVRPGKGFLPNFQLFAKGDVNGENEQKIFTFLKRSCPHPSETVVMSKHTFWEPIKVHDIRWNFEKFLVGPDGIPVMRWFHQAPVSTVKSDIMAYLSHFKTI

Gene Information

Entrez Gene ID
Gene Name
glutathione peroxidase 5
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0004602 IEA:UniProtKB-EC F glutathione peroxidase activity
GO:0006979 IEA:InterPro P response to oxidative stress

KEGG Pathway Links

KEGG Pathway ID Description
mmu00590 Arachidonic acid metabolism
mmu00480 Glutathione metabolism
mmu04918 Thyroid hormone synthesis

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR029759 Glutathione peroxidase active site
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase 5
Protein Entry
GPX5_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
Function Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
Similarity Belongs to the glutathione peroxidase family. {ECO:0000305}.
Subcellular Location Secreted.
Tissue Specificity Epididymis.

Identical and Related Proteins

Unique RefSeq proteins for LMP005479 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
171543846 RefSeq NP_034473 221 epididymal secretory glutathione peroxidase precursor

Identical Sequences to LMP005479 proteins

Reference Database Accession Length Protein Name
GI:171543846 SwissProt P21765.3 221 RecName: Full=Epididymal secretory glutathione peroxidase; AltName: Full=Epididymis-specific glutathione peroxidase-like protein; Short=EGLP; AltName: Full=Glutathione peroxidase 5; Short=GPx-5; Short=GSHPx-5; AltName: Full=Major androgen-regulated protein; AltName: Full=arMEP24; Flags: Precursor [Mus musculus]

Related Sequences to LMP005479 proteins

Reference Database Accession Length Protein Name
GI:171543846 DBBJ BAC26586.1 221 unnamed protein product [Mus musculus]
GI:171543846 GenBank AAI00750.1 221 Gpx5 protein [Mus musculus]
GI:171543846 GenBank AAI03589.1 221 Gpx5 protein [Mus musculus]
GI:171543846 GenBank AAI03590.1 221 Glutathione peroxidase 5 [Mus musculus]
GI:171543846 GenBank AAI05649.1 221 Gpx5 protein [Mus musculus]
GI:171543846 GenBank EDL32669.1 221 glutathione peroxidase 5 [Mus musculus]