Gene/Proteome Database (LMPD)

LMPD ID
LMP005378
Gene ID
Species
Mus musculus (Mouse)
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 11
Gene Symbol
Synonyms
DIPP3; DIPP3b
Alternate Names
diphosphoinositol polyphosphate phosphohydrolase 3-beta; DIPP3 beta; DIPP3-beta; DIPP-3-beta; nudix motif 11; nudix-type motif 11; nucleoside diphosphate-linked moiety X motif 11; diadenosine hexaphosphate hydrolase (AMP-forming)', "diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-beta
Chromosome
X
Map Location
X A1.1|X
EC Number
3.6.1.52

Proteins

diphosphoinositol polyphosphate phosphohydrolase 3-beta
Refseq ID NP_067406
Protein GI 72384359
UniProt ID P0C027
mRNA ID NM_021431
Length 164
RefSeq Status VALIDATED
MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPDGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVFVLTVTELLEDWEDSVSIGRKREWFKIEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSAAPSPPESEP

Gene Information

Entrez Gene ID
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 11
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0008486 IEA:UniProtKB-EC F diphosphoinositol-polyphosphate diphosphatase activity
GO:0052840 IEA:UniProtKB-EC F inositol diphosphate tetrakisphosphate diphosphatase activity
GO:0052846 IEA:UniProtKB-EC F inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity
GO:0052847 IEA:UniProtKB-EC F inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
GO:0052843 IEA:UniProtKB-EC F inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity
GO:0052848 IEA:UniProtKB-EC F inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
GO:0052844 IEA:UniProtKB-EC F inositol-3-diphosphate-1,2,4,5,6-pentakisphosphate diphosphatase activity
GO:0052845 IEA:UniProtKB-EC F inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding

REACTOME Pathway Links

REACTOME Pathway ID Description
5894026 Inositol phosphate metabolism
5892760 Metabolism
5894029 Synthesis of pyrophosphates in the cytosol

Domain Information

InterPro Annotations

Accession Description
IPR020476 NUDIX hydrolase
IPR000086 NUDIX hydrolase domain
IPR015797 NUDIX hydrolase domain-like
IPR020084 NUDIX hydrolase, conserved site

UniProt Annotations

Entry Information

Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 11
Protein Entry
NUD10_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Diphospho-myo-inositol polyphosphate + H(2)O = myo-inositol polyphosphate + phosphate. {ECO:0000269|PubMed:12689335}.
Catalytic Activity P(1),P(5)-bis(5'-adenosyl)pentaphosphate + H(2)O = adenosine 5'-tetraphosphate + AMP. {ECO:0000269|PubMed:12689335}.
Catalytic Activity P(1),P(6)-bis(5'-adenosyl)hexaphosphate + H(2)O = adenosine 5'-pentaphosphate + AMP. {ECO:0000269|PubMed:12689335}.
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250}; Note=Binds 3 Mg(2+) or Mn(2+) ions per subunit. Mn(2+) may be the true cofactor in vivo. {ECO:0000250};
Function Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate; however, the relevance of such activity in vivo remains unclear.
Miscellaneous Nudt10 and Nudt11 code for identical proteins, which gives their indidual characterization difficult. Thus, most experiments do not discriminate between the 2 proteins.
Similarity Belongs to the Nudix hydrolase family. DIPP subfamily. {ECO:0000305}.
Similarity Contains 1 nudix hydrolase domain. {ECO:0000255|PROSITE-ProRule:PRU00794}.
Subcellular Location Cytoplasm {ECO:0000250}.
Tissue Specificity Mainly expressed in testis, liver kidney and, at lower level, in heart, brain, spleen, lung and skeletal muscle. {ECO:0000269|PubMed:12689335}.

Identical and Related Proteins

Unique RefSeq proteins for LMP005378 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
72384359 RefSeq NP_067406 164 diphosphoinositol polyphosphate phosphohydrolase 3-beta

Identical Sequences to LMP005378 proteins

Reference Database Accession Length Protein Name
GI:72384359 RefSeq XP_003754791.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha isoform X1 [Rattus norvegicus]
GI:72384359 RefSeq XP_003752064.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-beta isoform X2 [Rattus norvegicus]
GI:72384359 RefSeq XP_006227353.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-beta isoform X1 [Rattus norvegicus]
GI:72384359 RefSeq XP_006256827.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-beta isoform X3 [Rattus norvegicus]
GI:72384359 RefSeq XP_006256828.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-beta isoform X4 [Rattus norvegicus]
GI:72384359 RefSeq XP_006527609.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha isoform X1 [Mus musculus]

Related Sequences to LMP005378 proteins

Reference Database Accession Length Protein Name
GI:72384359 DBBJ BAA95060.1 164 unnamed protein product, partial [Mus musculus]
GI:72384359 GenBank AAN41645.1 164 diphosphoinositol polyphosphate phosphohydrolase type 3 [Mus musculus]
GI:72384359 RefSeq XP_005085137.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha-like [Mesocricetus auratus]
GI:72384359 RefSeq XP_005352821.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha [Microtus ochrogaster]
GI:72384359 RefSeq XP_006995465.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha-like [Peromyscus maniculatus bairdii]
GI:72384359 RefSeq XP_006995466.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha [Peromyscus maniculatus bairdii]