Gene/Proteome Database (LMPD)
LMPD ID
LMP005377
Gene ID
Species
Mus musculus (Mouse)
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 10
Gene Symbol
Synonyms
AI853080; Dipp3a
Alternate Names
diphosphoinositol polyphosphate phosphohydrolase 3-alpha; DIPP3 alpha; DIPP3-alpha; DIPP-3-alpha; nudix motif 10; nucleoside diphosphate-linked moiety X motif 10; diadenosine hexaphosphate hydrolase (AMP-forming)', "diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-alpha
Chromosome
X
Map Location
X A1.1|X
EC Number
3.6.1.52
Proteins
| diphosphoinositol polyphosphate phosphohydrolase 3-alpha | |
|---|---|
| Refseq ID | NP_001026834 |
| Protein GI | 72384357 |
| UniProt ID | P0C027 |
| mRNA ID | NM_001031664 |
| Length | 164 |
| RefSeq Status | VALIDATED |
| MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPDGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVFVLTVTELLEDWEDSVSIGRKREWFKIEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSAAPSPPESEP | |
Gene Information
Entrez Gene ID
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 10
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0008486 | IEA:UniProtKB-EC | F | diphosphoinositol-polyphosphate diphosphatase activity |
| GO:0052840 | IEA:UniProtKB-EC | F | inositol diphosphate tetrakisphosphate diphosphatase activity |
| GO:0052846 | IEA:UniProtKB-EC | F | inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity |
| GO:0052847 | IEA:UniProtKB-EC | F | inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity |
| GO:0052843 | IEA:UniProtKB-EC | F | inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity |
| GO:0052848 | IEA:UniProtKB-EC | F | inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity |
| GO:0052844 | IEA:UniProtKB-EC | F | inositol-3-diphosphate-1,2,4,5,6-pentakisphosphate diphosphatase activity |
| GO:0052845 | IEA:UniProtKB-EC | F | inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 10
Protein Entry
NUD10_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Diphospho-myo-inositol polyphosphate + H(2)O = myo-inositol polyphosphate + phosphate. {ECO:0000269|PubMed:12689335}. |
| Catalytic Activity | P(1),P(5)-bis(5'-adenosyl)pentaphosphate + H(2)O = adenosine 5'-tetraphosphate + AMP. {ECO:0000269|PubMed:12689335}. |
| Catalytic Activity | P(1),P(6)-bis(5'-adenosyl)hexaphosphate + H(2)O = adenosine 5'-pentaphosphate + AMP. {ECO:0000269|PubMed:12689335}. |
| Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250}; Note=Binds 3 Mg(2+) or Mn(2+) ions per subunit. Mn(2+) may be the true cofactor in vivo. {ECO:0000250}; |
| Function | Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate; however, the relevance of such activity in vivo remains unclear. |
| Miscellaneous | Nudt10 and Nudt11 code for identical proteins, which gives their indidual characterization difficult. Thus, most experiments do not discriminate between the 2 proteins. |
| Similarity | Belongs to the Nudix hydrolase family. DIPP subfamily. {ECO:0000305}. |
| Similarity | Contains 1 nudix hydrolase domain. {ECO:0000255|PROSITE-ProRule:PRU00794}. |
| Subcellular Location | Cytoplasm {ECO:0000250}. |
| Tissue Specificity | Mainly expressed in testis, liver kidney and, at lower level, in heart, brain, spleen, lung and skeletal muscle. {ECO:0000269|PubMed:12689335}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP005377 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 72384357 | RefSeq | NP_001026834 | 164 | diphosphoinositol polyphosphate phosphohydrolase 3-alpha |
Identical Sequences to LMP005377 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:72384357 | RefSeq | XP_003754791.1 | 164 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha isoform X1 [Rattus norvegicus] |
| GI:72384357 | RefSeq | XP_003752064.1 | 164 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-beta isoform X2 [Rattus norvegicus] |
| GI:72384357 | RefSeq | XP_006227353.1 | 164 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-beta isoform X1 [Rattus norvegicus] |
| GI:72384357 | RefSeq | XP_006256827.1 | 164 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-beta isoform X3 [Rattus norvegicus] |
| GI:72384357 | RefSeq | XP_006256828.1 | 164 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-beta isoform X4 [Rattus norvegicus] |
| GI:72384357 | RefSeq | XP_006527609.1 | 164 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha isoform X1 [Mus musculus] |
Related Sequences to LMP005377 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:72384357 | DBBJ | BAA95060.1 | 164 | unnamed protein product, partial [Mus musculus] |
| GI:72384357 | GenBank | AAN41645.1 | 164 | diphosphoinositol polyphosphate phosphohydrolase type 3 [Mus musculus] |
| GI:72384357 | RefSeq | XP_005085137.1 | 164 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha-like [Mesocricetus auratus] |
| GI:72384357 | RefSeq | XP_005352821.1 | 164 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha [Microtus ochrogaster] |
| GI:72384357 | RefSeq | XP_006995465.1 | 164 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha-like [Peromyscus maniculatus bairdii] |
| GI:72384357 | RefSeq | XP_006995466.1 | 164 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha [Peromyscus maniculatus bairdii] |