Gene/Proteome Database (LMPD)
LMPD ID
LMP004884
Gene ID
Species
Homo sapiens (Human)
Gene Name
Rab geranylgeranyltransferase, beta subunit
Gene Symbol
Synonyms
GGTB
Chromosome
1
Map Location
1p31
Summary
This gene encodes the beta-subunit of the enzyme Rab geranylgeranyl-transferase (RabGGTase), which belongs to the protein prenyltransferase family. RabGGTase catalyzes the post-translational addition of geranylgeranyl groups to C-terminal cysteine residues of Rab GTPases. Three small nucleolar RNA genes are present in the intronic regions of this gene. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 3. [provided by RefSeq, Jan 2013]
Orthologs
Proteins
| geranylgeranyl transferase type-2 subunit beta | |
|---|---|
| Refseq ID | NP_004573 |
| Protein GI | 21359854 |
| UniProt ID | Q6IB63 |
| mRNA ID | NM_004582 |
| Length | 331 |
| RefSeq Status | REVIEWED |
| MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS | |
Gene Information
Entrez Gene ID
Gene Name
Rab geranylgeranyltransferase, beta subunit
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0004663 | IEA:InterPro | F | Rab geranylgeranyltransferase activity |
| GO:0018344 | IEA:InterPro | P | protein geranylgeranylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
Rab geranylgeranyltransferase, beta subunit
Protein Entry
PGTB2_HUMAN
UniProt ID
Species
Human
Identical and Related Proteins
Unique RefSeq proteins for LMP004884 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 21359854 | RefSeq | NP_004573 | 331 | geranylgeranyl transferase type-2 subunit beta |
Identical Sequences to LMP004884 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21359854 | GenBank | AIC49557.1 | 331 | RABGGTB, partial [synthetic construct] |
| GI:21359854 | RefSeq | XP_007976447.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Chlorocebus sabaeus] |
| GI:21359854 | RefSeq | XP_008954275.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Pan paniscus] |
| GI:21359854 | RefSeq | XP_009247146.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Pongo abelii] |
| GI:21359854 | RefSeq | XP_009421905.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Pan troglodytes] |
| GI:21359854 | RefSeq | XP_010366901.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Rhinopithecus roxellana] |
Related Sequences to LMP004884 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21359854 | GenBank | AAA91473.1 | 331 | geranylgeranyl transferase type II beta-subunit [Homo sapiens] |
| GI:21359854 | GenBank | AED45666.1 | 330 | Sequence 1818 from patent US 7892730 |
| GI:21359854 | GenBank | JAB02328.1 | 331 | geranylgeranyl transferase type-2 subunit beta [Callithrix jacchus] |
| GI:21359854 | GenBank | JAB16211.1 | 331 | geranylgeranyl transferase type-2 subunit beta [Callithrix jacchus] |
| GI:21359854 | GenBank | JAB33185.1 | 331 | geranylgeranyl transferase type-2 subunit beta [Callithrix jacchus] |
| GI:21359854 | RefSeq | XP_004026043.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta [Gorilla gorilla gorilla] |