Gene/Proteome Database (LMPD)

LMPD ID
LMP004884
Gene ID
Species
Homo sapiens (Human)
Gene Name
Rab geranylgeranyltransferase, beta subunit
Gene Symbol
Synonyms
GGTB
Chromosome
1
Map Location
1p31
Summary
This gene encodes the beta-subunit of the enzyme Rab geranylgeranyl-transferase (RabGGTase), which belongs to the protein prenyltransferase family. RabGGTase catalyzes the post-translational addition of geranylgeranyl groups to C-terminal cysteine residues of Rab GTPases. Three small nucleolar RNA genes are present in the intronic regions of this gene. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 3. [provided by RefSeq, Jan 2013]
Orthologs

Proteins

geranylgeranyl transferase type-2 subunit beta
Refseq ID NP_004573
Protein GI 21359854
UniProt ID Q6IB63
mRNA ID NM_004582
Length 331
RefSeq Status REVIEWED
MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS

Gene Information

Entrez Gene ID
Gene Name
Rab geranylgeranyltransferase, beta subunit
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0004663 IEA:InterPro F Rab geranylgeranyltransferase activity
GO:0018344 IEA:InterPro P protein geranylgeranylation

Domain Information

InterPro Annotations

Accession Description
IPR026873 Geranylgeranyl transferase type-2 subunit beta
IPR001330 Prenyltransferase/squalene oxidase
IPR008930 Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid

UniProt Annotations

Entry Information

Gene Name
Rab geranylgeranyltransferase, beta subunit
Protein Entry
PGTB2_HUMAN
UniProt ID
Species
Human

Identical and Related Proteins

Unique RefSeq proteins for LMP004884 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21359854 RefSeq NP_004573 331 geranylgeranyl transferase type-2 subunit beta

Identical Sequences to LMP004884 proteins

Reference Database Accession Length Protein Name
GI:21359854 GenBank AIC49557.1 331 RABGGTB, partial [synthetic construct]
GI:21359854 RefSeq XP_007976447.1 331 PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Chlorocebus sabaeus]
GI:21359854 RefSeq XP_008954275.1 331 PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Pan paniscus]
GI:21359854 RefSeq XP_009247146.1 331 PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Pongo abelii]
GI:21359854 RefSeq XP_009421905.1 331 PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Pan troglodytes]
GI:21359854 RefSeq XP_010366901.1 331 PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Rhinopithecus roxellana]

Related Sequences to LMP004884 proteins

Reference Database Accession Length Protein Name
GI:21359854 GenBank AAA91473.1 331 geranylgeranyl transferase type II beta-subunit [Homo sapiens]
GI:21359854 GenBank AED45666.1 330 Sequence 1818 from patent US 7892730
GI:21359854 GenBank JAB02328.1 331 geranylgeranyl transferase type-2 subunit beta [Callithrix jacchus]
GI:21359854 GenBank JAB16211.1 331 geranylgeranyl transferase type-2 subunit beta [Callithrix jacchus]
GI:21359854 GenBank JAB33185.1 331 geranylgeranyl transferase type-2 subunit beta [Callithrix jacchus]
GI:21359854 RefSeq XP_004026043.1 331 PREDICTED: geranylgeranyl transferase type-2 subunit beta [Gorilla gorilla gorilla]