Gene/Proteome Database (LMPD)
LMPD ID
LMP004575
Gene ID
Species
Homo sapiens (Human)
Gene Name
globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
Gene Symbol
Synonyms
A3GALNT; FS; UNQ2513
Chromosome
9
Map Location
9q34.13-q34.3
EC Number
2.4.1.-
Summary
This gene encodes a glycosyltransferase that plays a role in the synthesis of Forssman glycolipid (FG), a member of the globoseries glycolipid family. Glycolipids such as FG form attachment sites for the binding of pathogens to cells; expression of this protein may determine host tropism to microorganisms. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]
Orthologs
Proteins
| globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform 1 | |
|---|---|
| Refseq ID | NP_068836 |
| Protein GI | 32484985 |
| UniProt ID | Q8N5D6 |
| mRNA ID | NM_021996 |
| Length | 347 |
| RefSeq Status | REVIEWED |
| MHRRRLALGLGFCLLAGTSLSVLWVYLENWLPVSYVPYYLPCPEIFNMKLHYKREKPLQPVVWSQYPQPKLLEHRPTQLLTLTPWLAPIVSEGTFNPELLQHIYQPLNLTIGVTVFAVGKYTHFIQSFLESAEEFFMRGYRVHYYIFTDNPAAVPGVPLGPHRLLSSIPIQGHSHWEETSMRRMETISQHIAKRAHREVDYLFCLDVDMVFRNPWGPETLGDLVAAIHPSYYAVPRQQFPYERRRVSTAFVADSEGDFYYGGAVFGGQVARVYEFTRGCHMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLRS | |
| globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform 2 | |
|---|---|
| Refseq ID | NP_001269558 |
| Protein GI | 544063402 |
| UniProt ID | Q8N5D6 |
| mRNA ID | NM_001282629 |
| Length | 294 |
| RefSeq Status | REVIEWED |
| MHRRRLALGLGFCLLAGTSLSVLWVYLENWLPVSYVPYYLPCPEIFNMKLHYKREKPLQPVVWSQYPQPKLLEHRPTQLLTLTPWLAPIVSEGTFNPELLQHIYQPLNLTIGVTVFAVGNPSWSQPRSSSCVGTGCTTTSSLTTLQPFPGSRWVPTGFSAPSPSRVTPTGRRHPCAGWRPSASTLLRGLTGRWTTSSALMWTWCFGTRGALRPWETWWLPFTQATTPFPASSSPMSAGVFPLPLWQTAKGTSIMVGQSSGGRWPGYMSLLGAATWPSWRTRPMASWLPGGRKAT | |
| globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform 3 | |
|---|---|
| Refseq ID | NP_001269561 |
| Protein GI | 544063430 |
| UniProt ID | Q8N5D6 |
| mRNA ID | NM_001282632 |
| Length | 330 |
| RefSeq Status | REVIEWED |
| MHRRRLALGLGFCLLAGTSLSVLWVYLENWLPVSYVPYYLPCPEILSQYPQPKLLEHRPTQLLTLTPWLAPIVSEGTFNPELLQHIYQPLNLTIGVTVFAVGKYTHFIQSFLESAEEFFMRGYRVHYYIFTDNPAAVPGVPLGPHRLLSSIPIQGHSHWEETSMRRMETISQHIAKRAHREVDYLFCLDVDMVFRNPWGPETLGDLVAAIHPSYYAVPRQQFPYERRRVSTAFVADSEGDFYYGGAVFGGQVARVYEFTRGCHMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLRS | |
| globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform 4 | |
|---|---|
| Refseq ID | NP_001275501 |
| Protein GI | 544063430 |
| UniProt ID | Q8N5D6 |
| mRNA ID | NM_001288572 |
| Length | 330 |
| RefSeq Status | REVIEWED |
| MHRRRLALGLGFCLLAGTSLSVLWVYLENWLPVSYVPYYLPCPEILSQYPQPKLLEHRPTQLLTLTPWLAPIVSEGTFNPELLQHIYQPLNLTIGVTVFAVGKYTHFIQSFLESAEEFFMRGYRVHYYIFTDNPAAVPGVPLGPHRLLSSIPIQGHSHWEETSMRRMETISQHIAKRAHREVDYLFCLDVDMVFRNPWGPETLGDLVAAIHPSYYAVPRQQFPYERRRVSTAFVADSEGDFYYGGAVFGGQVARVYEFTRGCHMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLRS | |
| globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform 5 | |
|---|---|
| Refseq ID | NP_001275502 |
| Protein GI | 568384828 |
| UniProt ID | Q8N5D6 |
| mRNA ID | NM_001288573 |
| Length | 211 |
| RefSeq Status | REVIEWED |
| MRGYRVHYYIFTDNPAAVPGVPLGPHRLLSSIPIQGHSHWEETSMRRMETISQHIAKRAHREVDYLFCLDVDMVFRNPWGPETLGDLVAAIHPSYYAVPRQQFPYERRRVSTAFVADSEGDFYYGGAVFGGQVARVYEFTRGCHMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLRS | |
Gene Information
Entrez Gene ID
Gene Name
globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0047277 | IEA:Ensembl | F | globoside alpha-N-acetylgalactosaminyltransferase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0009247 | TAS:ProtInc | P | glycolipid biosynthetic process |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
Protein Entry
GBGT1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8N5D6-1; Sequence=Displayed; Name=2; IsoId=Q8N5D6-2; Sequence=VSP_013750; Note=No experimental confirmation available.; Name=3; IsoId=Q8N5D6-3; Sequence=VSP_055375; Note=No experimental confirmation available.; |
| Caution | In contrast to its mouse or canine ortholog, it does not mediate the formation of Forssman glycolipid (also called Forssman antigen; FG), which does not exist in human. It is unknown whether it has no enzyme activity at all or has some distinct substrate specificity compared to the canine and mouse protein. |
| Cofactor | Name=Mn(2+); Xref=ChEBI |
| Domain | The conserved DXD motif is involved in cofactor binding. The manganese ion interacts with the beta-phosphate group of UDP and may also have a role in catalysis (By similarity). |
| Function | Catalyzes the formation of some glycolipid via the addition of N-acetylgalactosamine (GalNAc) in alpha-1,3-linkage to some substrate. Glycolipids probably serve for adherence of some pathogens. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 6 family. |
| Subcellular Location | Golgi apparatus membrane ; Single-pass type II membrane protein . |
| Tissue Specificity | Widely expressed. Expressed at higher level in placenta, ovary and peripheral blood leukocyte, whereas it is weakly expressed in liver, thymus, and testis. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_479"; |
| Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=GBGT1"; |
| Web Resource | Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/gbgt1/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP004575 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 32484985 | RefSeq | NP_068836 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform 1 |
| 544063402 | RefSeq | NP_001269558 | 294 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform 2 |
| 544063430 | RefSeq | NP_001269561 | 330 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform 3 |
| 544063430 | RefSeq | NP_001275501 | 330 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform 4 |
| 568384828 | RefSeq | NP_001275502 | 211 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform 5 |
Identical Sequences to LMP004575 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:32484985 | DBBJ | BAF84187.1 | 347 | unnamed protein product [Homo sapiens] |
| GI:544063430 | DBBJ | BAH14061.1 | 330 | unnamed protein product [Homo sapiens] |
| GI:544063430 | DBBJ | BAH14061.1 | 330 | unnamed protein product [Homo sapiens] |
| GI:568384828 | EMBL | CAF86142.1 | 211 | unnamed protein product [Homo sapiens] |
| GI:32484985 | EMBL | CCD30590.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Homo sapiens] |
| GI:32484985 | GenBank | AAZ38721.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Homo sapiens] |
| GI:544063402 | GenBank | EAW88043.1 | 294 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1, isoform CRA_a [Homo sapiens] |
| GI:32484985 | GenBank | EAW88045.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1, isoform CRA_c [Homo sapiens] |
| GI:568384828 | GenBank | EAW88046.1 | 211 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1, isoform CRA_d [Homo sapiens] |
| GI:32484985 | GenBank | ACM84351.1 | 347 | Sequence 9849 from patent US 6812339 |
| GI:32484985 | GenBank | AEK15993.1 | 347 | Sequence 113 from patent US 7977052 |
Related Sequences to LMP004575 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:544063402 | DBBJ | BAC11106.1 | 294 | unnamed protein product [Homo sapiens] |
| GI:32484985 | DBBJ | BAG36792.1 | 347 | unnamed protein product [Homo sapiens] |
| GI:544063402 | EMBL | CAF85881.1 | 294 | unnamed protein product [Homo sapiens] |
| GI:544063430 | EMBL | CCD30588.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Homo sapiens] |
| GI:544063430 | EMBL | CCD30588.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Homo sapiens] |
| GI:544063430 | EMBL | CCD30589.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Homo sapiens] |
| GI:544063430 | EMBL | CCD30589.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Homo sapiens] |
| GI:568384828 | EMBL | CCD30590.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Homo sapiens] |
| GI:32484985 | EMBL | CCD30591.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Homo sapiens] |
| GI:32484985 | GenBank | AAF06145.1 | 347 | Forssman glycolipid synthetase [Homo sapiens] |
| GI:32484985 | GenBank | AAH32499.1 | 347 | Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Homo sapiens] |
| GI:32484985 | GenBank | AAQ88542.1 | 347 | glycosyltransferase [Homo sapiens] |
| GI:568384828 | GenBank | AAZ38721.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Homo sapiens] |
| GI:568384828 | GenBank | EAW88045.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1, isoform CRA_c [Homo sapiens] |
| GI:568384828 | GenBank | ACM84351.1 | 347 | Sequence 9849 from patent US 6812339 |
| GI:544063430 | GenBank | JAA13905.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Pan troglodytes] |
| GI:544063430 | GenBank | JAA13905.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Pan troglodytes] |
| GI:544063430 | GenBank | JAA27717.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Pan troglodytes] |
| GI:544063430 | GenBank | JAA27717.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Pan troglodytes] |
| GI:544063430 | GenBank | JAA40875.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Pan troglodytes] |
| GI:544063430 | GenBank | JAA40875.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Pan troglodytes] |
| GI:32484985 | GenBank | AIC56181.1 | 347 | GBGT1, partial [synthetic construct] |
| GI:568384828 | RefSeq | NP_068836.2 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform 1 [Homo sapiens] |
| GI:544063402 | RefSeq | XP_008004005.1 | 294 | PREDICTED: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform X6 [Chlorocebus sabaeus] |
| GI:544063402 | RefSeq | XP_009197013.1 | 294 | PREDICTED: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform X6 [Papio anubis] |
| GI:544063430 | RefSeq | XP_009455867.1 | 382 | PREDICTED: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform X8 [Pan troglodytes] |
| GI:544063430 | RefSeq | XP_009455867.1 | 382 | PREDICTED: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform X8 [Pan troglodytes] |
| GI:544063402 | RefSeq | XP_009455874.1 | 346 | PREDICTED: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform X15 [Pan troglodytes] |
| GI:544063402 | RefSeq | XP_010371108.1 | 316 | PREDICTED: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform X3 [Rhinopithecus roxellana] |
| GI:568384828 | SwissProt | Q8N5D6.2 | 347 | RecName: Full=Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1; AltName: Full=Forssman glycolipid synthase-like protein [Homo sapiens] |