Gene/Proteome Database (LMPD)
LMPD ID
LMP004491
Gene ID
Species
Homo sapiens (Human)
Gene Name
abhydrolase domain containing 4
Gene Symbol
Synonyms
ABH4
Alternate Names
abhydrolase domain-containing protein 4; alpha/beta-hydrolase 4; lyso-N-acylphosphatidylethanolamine lipase
Chromosome
14
Map Location
14q11.2
EC Number
3.1.1.-
Proteins
| abhydrolase domain-containing protein 4 | |
|---|---|
| Refseq ID | NP_071343 |
| Protein GI | 50658087 |
| UniProt ID | Q8TB40 |
| mRNA ID | NM_022060 |
| Length | 342 |
| RefSeq Status | VALIDATED |
| MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD | |
Gene Information
Entrez Gene ID
Gene Name
abhydrolase domain containing 4
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016787 | IEA:UniProtKB-KW | F | hydrolase activity |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8TB40-1; Sequence=Displayed; Name=2; IsoId=Q8TB40-2; Sequence=VSP_056924, VSP_056925; Note=No experimental confirmation available; |
| Caution | Thr-291 is present instead of the conserved His which is expected to be an active site residue. |
| Function | Lysophospholipase selective for N-acyl phosphatidylethanolamine (NAPE). Contributes to the biosynthesis of N-acyl ethanolamines, including the endocannabinoid anandamide by hydrolyzing the sn-1 and sn-2 acyl chains from N-acyl phosphatidylethanolamine (NAPE) generating glycerophospho-N-acyl ethanolamine (GP-NAE), an intermediate for N-acyl ethanolamine biosynthesis. Hydrolyzes substrates bearing saturated, monounsaturated, polyunsaturated N-acyl chains. Shows no significant activity towards other lysophospholipids, including lysophosphatidylcholine, lysophosphatidylethanolamine and lysophosphatidylserine (By similarity). |
| Similarity | Belongs to the peptidase S33 family. ABHD4/ABHD5 subfamily. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004491 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 50658087 | RefSeq | NP_071343 | 342 | abhydrolase domain-containing protein 4 |
Identical Sequences to LMP004491 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50658087 | GenBank | JAA11687.1 | 342 | abhydrolase domain containing 4 [Pan troglodytes] |
| GI:50658087 | GenBank | JAA22559.1 | 342 | abhydrolase domain containing 4 [Pan troglodytes] |
| GI:50658087 | GenBank | AIC52089.1 | 342 | ABHD4, partial [synthetic construct] |
| GI:50658087 | GenBank | AIC52090.1 | 342 | ABHD4, partial [synthetic construct] |
| GI:50658087 | RefSeq | XP_004054950.1 | 342 | PREDICTED: abhydrolase domain-containing protein 4 [Gorilla gorilla gorilla] |
| GI:50658087 | RefSeq | XP_009425734.1 | 342 | PREDICTED: abhydrolase domain-containing protein 4 [Pan troglodytes] |
Related Sequences to LMP004491 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50658087 | DBBJ | BAB14289.1 | 342 | unnamed protein product [Homo sapiens] |
| GI:50658087 | EMBL | CAE90713.1 | 342 | unnamed protein product [Homo sapiens] |
| GI:50658087 | EMBL | CBN68794.1 | 342 | unnamed protein product [Homo sapiens] |
| GI:50658087 | EMBL | CBN69750.1 | 342 | unnamed protein product [Homo sapiens] |
| GI:50658087 | RefSeq | XP_003260617.1 | 342 | PREDICTED: abhydrolase domain-containing protein 4 [Nomascus leucogenys] |
| GI:50658087 | RefSeq | XP_005560854.1 | 342 | PREDICTED: abhydrolase domain-containing protein 4-like isoform X1 [Macaca fascicularis] |