Gene/Proteome Database (LMPD)
LMPD ID
LMP004382
Gene ID
Species
Mus musculus (Mouse)
Gene Name
branched chain ketoacid dehydrogenase E1, beta polypeptide
Gene Symbol
Synonyms
-
Alternate Names
2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; BCKDE1B; BCKDH E1-beta; branched-chain alpha-keto acid dehydrogenase E1 component beta chain
Chromosome
9
Map Location
9 E2|9
EC Number
1.2.4.4
Proteins
| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial | |
|---|---|
| Refseq ID | NP_954665 |
| Protein GI | 40353220 |
| UniProt ID | Q6P3A8 |
| mRNA ID | NM_199195 |
| Length | 322 |
| RefSeq Status | PROVISIONAL |
| MNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQVPVEPYKIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVIDLRTIVPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY | |
Gene Information
Entrez Gene ID
Gene Name
branched chain ketoacid dehydrogenase E1, beta polypeptide
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005947 | ISS:HGNC | C | mitochondrial alpha-ketoglutarate dehydrogenase complex |
| GO:0005743 | TAS:MGI | C | mitochondrial inner membrane |
| GO:0005739 | ISS:HGNC | C | mitochondrion |
| GO:0003863 | IEA:UniProtKB-EC | F | 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity |
| GO:0003826 | IDA:MGI | F | alpha-ketoacid dehydrogenase activity |
| GO:0009083 | ISS:HGNC | P | branched-chain amino acid catabolic process |
| GO:0009063 | TAS:MGI | P | cellular amino acid catabolic process |
BIOCYC Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5892792 | Branched-chain amino acid catabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
branched chain ketoacid dehydrogenase E1, beta polypeptide
Protein Entry
ODBB_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q6P3A8-1; Sequence=Displayed; Name=2; IsoId=Q6P3A8-2; Sequence=VSP_029841; Note=No experimental confirmation available.; |
| Catalytic Activity | 3-methyl-2-oxobutanoate + [dihydrolipoyllysine-residue (2-methylpropanoyl)transferase] lipoyllysine = [dihydrolipoyllysine-residue (2- methylpropanoyl)transferase] S-(2- methylpropanoyl)dihydrolipoyllysine + CO(2). |
| Function | The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3). |
| Subcellular Location | Mitochondrion matrix. |
| Subunit | Heterotetramer of 2 alpha and 2 beta chains. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004382 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 40353220 | RefSeq | NP_954665 | 322 | 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial |
Identical Sequences to LMP004382 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:40353220 | GenBank | AAH64099.1 | 322 | Branched chain ketoacid dehydrogenase E1, beta polypeptide [Mus musculus] |
Related Sequences to LMP004382 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:40353220 | GenBank | EDL77651.1 | 390 | branched chain keto acid dehydrogenase E1, beta polypeptide [Rattus norvegicus] |
| GI:40353220 | GenBank | AGU32431.1 | 390 | Sequence 118 from patent US 8507277 |
| GI:40353220 | PIR | - | 390 | 3-methyl-2-oxobutanoate dehydrogenase (lipoamide) (EC 1.2.4.4) - mouse [Mus musculus] |
| GI:40353220 | RefSeq | NP_062140.1 | 390 | 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial precursor [Rattus norvegicus] |
| GI:40353220 | RefSeq | XP_006510848.1 | 390 | PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial isoform X1 [Mus musculus] |
| GI:40353220 | SwissProt | P35738.3 | 390 | RecName: Full=2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; AltName: Full=Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; Short=BCKDE1B; Short=BCKDH E1-beta; Flags: Precursor [Rattus norvegicus] |