Gene/Proteome Database (LMPD)

LMPD ID
LMP004297
Gene ID
15446
Species
Mus musculus (Mouse)
Gene Name
hydroxyprostaglandin dehydrogenase 15 (NAD)
Gene Symbol
Hpgd
Synonyms
15-PGDH; AV026552
Alternate Names
15-hydroxyprostaglandin dehydrogenase [NAD(+)]; PGDH; prostaglandin dehydrogenase 1; 15-hydroxyprostaglandin dehydrogenase
Chromosome
8
Map Location
8 B3.2|8
EC Number
1.1.1.141

Proteins

15-hydroxyprostaglandin dehydrogenase [NAD(+)]
Refseq ID NP_032304
Protein GI 124486706
UniProt ID Q8VCC1
mRNA ID NM_008278
Length 269
RefSeq Status VALIDATED
MHVNGKVALVTGAAQGIGKAFAEALLLHGAKVALVDWNLEAGVKCKAALDEQFEPQKTLFVQCDVADQKQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVDTPILESIEKEENMGQYIEYKDQIKAMMKFYGVLHPSTIANGLINLIEDDALNGAIMKITASKGIHFQDYDISPLLVKAPLTS

Gene Information

Entrez Gene ID
15446
Gene Name
hydroxyprostaglandin dehydrogenase 15 (NAD)
Gene Symbol
Hpgd
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016323 IDA:MGI C basolateral plasma membrane
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016404 ISS:UniProtKB F 15-hydroxyprostaglandin dehydrogenase (NAD+) activity
GO:0051287 ISS:UniProtKB F NAD binding
GO:0070403 ISS:UniProtKB F NAD+ binding
GO:0003824 ISS:UniProtKB F catalytic activity
GO:0004957 ISS:UniProtKB F prostaglandin E receptor activity
GO:0097070 IMP:UniProtKB P ductus arteriosus closure
GO:0007565 ISS:UniProtKB P female pregnancy
GO:0045786 ISS:UniProtKB P negative regulation of cell cycle
GO:0030728 ISS:UniProtKB P ovulation
GO:0007567 ISS:UniProtKB P parturition
GO:0006693 ISS:UniProtKB P prostaglandin metabolic process
GO:0070493 ISS:UniProtKB P thrombin receptor signaling pathway
GO:0007179 ISS:UniProtKB P transforming growth factor beta receptor signaling pathway

KEGG Pathway Links

KEGG Pathway ID Description
mmu05202 Transcriptional misregulation in cancer

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY3DJ-35583 biosynthesis of prostaglandins

REACTOME Pathway Links

REACTOME Pathway ID Description
5894063 Synthesis of Lipoxins (LX)
5893002 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxyprostaglandin dehydrogenase 15 (NAD)
Protein Entry
PGDH_MOUSE
UniProt ID
Q8VCC1
Species
Mouse

Comments

Comment Type Description
Catalytic Activity (5Z,13E,15S)-11-alpha,15-dihydroxy-9-oxoprost- 5,13-dienoate + NAD(+) = (5Z,13E)-11-alpha-hydroxy-9,15- dioxoprost-5,13-dienoate + NADH.
Function Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4 (By similarity). {ECO:0000250}.
Sequence Caution Sequence=AAB41825.1; Type=Frameshift; Positions=267; Evidence={ECO:0000305};
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}.
Subcellular Location Cytoplasm {ECO:0000250}.
Subunit Homodimer. {ECO:0000250}.
Tissue Specificity Expressed in lung, intestine, stomach and liver. {ECO:0000269|PubMed:8950170}.

Identical and Related Proteins

Unique RefSeq proteins for LMP004297 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
124486706 RefSeq NP_032304 269 15-hydroxyprostaglandin dehydrogenase [NAD(+)]

Identical Sequences to LMP004297 proteins

Reference Database Accession Length Protein Name
GI:124486706 DBBJ BAE26850.1 269 unnamed protein product [Mus musculus]
GI:124486706 GenBank AAH21157.1 269 Hydroxyprostaglandin dehydrogenase 15 (NAD) [Mus musculus]
GI:124486706 GenBank EDL28603.1 269 hydroxyprostaglandin dehydrogenase 15 (NAD) [Mus musculus]
GI:124486706 SwissProt Q8VCC1.1 269 RecName: Full=15-hydroxyprostaglandin dehydrogenase [NAD(+)]; Short=15-PGDH; AltName: Full=Prostaglandin dehydrogenase 1 [Mus musculus]

Related Sequences to LMP004297 proteins

Reference Database Accession Length Protein Name
GI:124486706 GenBank AAB41825.1 266 NAD(+)-dependent 15-hydroxyprostaglandin dehydrogenase [Mus musculus]
GI:124486706 GenBank AAB53027.1 266 NAD-dependent 15-hydroxyprostaglandin dehydrogenase [Rattus norvegicus]
GI:124486706 GenBank AAH62399.1 266 Hydroxyprostaglandin dehydrogenase 15 (NAD) [Rattus norvegicus]
GI:124486706 GenBank EDL87138.1 266 hydroxyprostaglandin dehydrogenase 15 (NAD) [Rattus norvegicus]
GI:124486706 RefSeq NP_077366.2 266 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Rattus norvegicus]
GI:124486706 SwissProt O08699.2 266 RecName: Full=15-hydroxyprostaglandin dehydrogenase [NAD(+)]; Short=15-PGDH; AltName: Full=Prostaglandin dehydrogenase 1 [Rattus norvegicus]