Gene/Proteome Database (LMPD)

LMPD ID
LMP003937
Gene ID
68801
Species
Mus musculus (Mouse)
Gene Name
ELOVL family member 5, elongation of long chain fatty acids (yeast)
Gene Symbol
Elovl5
Synonyms
1110059L23Rik; AI747313; AU043003; HELO1
Alternate Names
elongation of very long chain fatty acids protein 5; ELOVL FA elongase 5; fatty acid elongase 1; ELOVL fatty acid elongase 5; 3-keto acyl-CoA synthase Elovl5; very-long-chain 3-oxoacyl-CoA synthase 5; homolog of yeast long chain polyunsaturated fatty acid elongation enzyme
Chromosome
9
Map Location
9 E1|9
EC Number
2.3.1.199

Proteins

elongation of very long chain fatty acids protein 5
Refseq ID NP_599016
Protein GI 31981653
UniProt ID Q8BHI7
mRNA ID NM_134255
Length 299
RefSeq Status VALIDATED
MEHFDASLSTYFKAFLGPRDTRVKGWFLLDNYIPTFVCSVIYLLIVWLGPKYMKNRQPFSCRGILQLYNLGLTLLSLYMFYELVTGVWEGKYNFFCQGTRSAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSIPSMRPYLWWKKYITQGQLVQFVLTIIQTTCGVFWPCSFPLGWLFFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKGHQNGSVAAVNGHTNSFPSLENSVKPRKQRKD

Gene Information

Entrez Gene ID
68801
Gene Name
ELOVL family member 5, elongation of long chain fatty acids (yeast)
Gene Symbol
Elovl5
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0009922 ISS:UniProtKB F fatty acid elongase activity
GO:0034625 ISS:UniProtKB P fatty acid elongation, monounsaturated fatty acid
GO:0034626 ISS:UniProtKB P fatty acid elongation, polyunsaturated fatty acid
GO:0006636 IEA:UniProtKB-UniPathway P unsaturated fatty acid biosynthetic process
GO:0042761 ISS:UniProtKB P very long-chain fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu01040 Biosynthesis of unsaturated fatty acids
mmu00062 Fatty acid elongation

REACTOME Pathway Links

REACTOME Pathway ID Description
5894052 Linoleic acid (LA) metabolism

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
ELOVL family member 5, elongation of long chain fatty acids (yeast)
Protein Entry
ELOV5_MOUSE
UniProt ID
Q8BHI7
Species
Mouse

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2).
Function Condensing enzyme that catalyzes the synthesis of monounsaturated and of polyunsaturated very long chain fatty acids. {ECO:0000250}.
Pathway Lipid metabolism; polyunsaturated fatty acid biosynthesis.
Similarity Belongs to the ELO family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP003937 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
31981653 RefSeq NP_599016 299 elongation of very long chain fatty acids protein 5

Identical Sequences to LMP003937 proteins

Reference Database Accession Length Protein Name
GI:31981653 GenBank ABA13357.1 299 Sequence 64 from patent US 6913916
GI:31981653 GenBank ACE40472.1 299 Sequence 66 from patent US 7375205
GI:31981653 GenBank ADR85382.1 299 Sequence 57 from patent US 7736884
GI:31981653 GenBank AEJ72125.1 299 Sequence 66 from patent US 7968692
GI:31981653 RefSeq XP_006511463.1 299 PREDICTED: elongation of very long chain fatty acids protein 5 isoform X2 [Mus musculus]
GI:31981653 SwissProt Q8BHI7.1 299 RecName: Full=Elongation of very long chain fatty acids protein 5; AltName: Full=3-keto acyl-CoA synthase Elovl5; AltName: Full=ELOVL fatty acid elongase 5; Short=ELOVL FA elongase 5; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 5 [Mus musculus]

Related Sequences to LMP003937 proteins

Reference Database Accession Length Protein Name
GI:31981653 DBBJ BAC32290.1 299 unnamed protein product [Mus musculus]
GI:31981653 DBBJ BAC40176.1 299 unnamed protein product [Mus musculus]
GI:31981653 GenBank AAH22911.1 299 ELOVL family member 5, elongation of long chain fatty acids (yeast) [Mus musculus]
GI:31981653 GenBank EDL26357.1 299 ELOVL family member 5, elongation of long chain fatty acids (yeast), isoform CRA_a [Mus musculus]
GI:31981653 GenBank AHM63728.1 299 ELOVL family member 5, partial [Mus musculus domesticus]
GI:31981653 RefSeq XP_006511462.1 340 PREDICTED: elongation of very long chain fatty acids protein 5 isoform X1 [Mus musculus]