Gene/Proteome Database (LMPD)

LMPD ID
LMP003838
Gene ID
72054
Species
Mus musculus (Mouse)
Gene Name
cytochrome P450, family 4, subfamily f, polypeptide 18
Gene Symbol
Cyp4f18
Synonyms
1810054N16Rik; Cyp4f3; Cypf18
Chromosome
8
Map Location
8|8 C1

Proteins

leukotriene-B(4) omega-hydroxylase 2 precursor
Refseq ID NP_077764
Protein GI 251823870
UniProt ID Q99N16
mRNA ID NM_024444
Length 524
RefSeq Status VALIDATED
MSQLSMSWMGLGHTAASPWLLLLLAGASCLLAYILTPIYGVFENSLRLRCFPQPPKRNWILGHLGLIQSSEEGLLYIQSLVRTFRDACCWWVGPLHPVIRIFHPAFIKPVVLAPALVAPKDTVFYRFLKPWLGDGLLMSTGDKWSRHRRMLTPAFHFNILKPYVKVFNDSTNIMHAKWQRLASKGSAYLNMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYITAILELSTLVARRHQRLLLHVDLFYYLTHDGMRFRKACRLVHDFTDAVIRERRRTLLDQGGVDVLKAKAKAKTLDFIDVLLLSKDEHGKALSDEDIRAEADTFMFGGHDTTASGLSWILYNLARHPEYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPVTAISRCCTQDIVLPDGRVIPKGVISRISIFGTHHNPAVWPDPEVYDPFRFDADNVKGRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRVLPDDKEPRRKPELILRAEGGLWLKVEPLSAGAQ
sig_peptide: 1..16 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1708 peptide sequence: MSQLSMSWMGLGHTAA

Gene Information

Entrez Gene ID
72054
Gene Name
cytochrome P450, family 4, subfamily f, polypeptide 18
Gene Symbol
Cyp4f18
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0052871 IEA:UniProtKB-EC F alpha-tocopherol omega-hydroxylase activity
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0050051 IEA:UniProtKB-EC F leukotriene-B4 20-monooxygenase activity

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 4, subfamily f, polypeptide 18
Protein Entry
Q99N16_MOUSE
UniProt ID
Q99N16
Species
Mouse

Comments

Comment Type Description
Catalytic Activity (6Z,8E,10E,14Z)-(5S,12R)-5,12-dihydroxyicosa- 6,8,10,14-tetraenoate + NADPH + O(2) = (6Z,8E,10E,14Z)-(5S,12R)- 5,12,20-trihydroxyicosa-6,8,10,14-tetraenoate + NADP(+) + H(2)O.
Cofactor Name=heme; Xref=ChEBI:CHEBI:30413; Evidence= ;
Enzyme Regulation Inhibited by carbon monoxide (CO).
Function Cytochromes P450 are a group of heme-thiolate monooxygenases. This enzyme requires molecular oxygen and NADPH for the omega-hydroxylation of LTB4, a potent chemoattractant for polymorphonuclear leukocytes. {ECO:0000250|UniProtKB:Q08477, ECO:0000269|PubMed:16380383}.
Induction Up-regulated in myeloid dendritic cells upon induction with LPS in vitro. Down-regulated upon migration of induced cells to the lymph node.
Pathway Lipid metabolism; leukotriene B4 degradation.
Similarity Belongs to the cytochrome P450 family.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein . Microsome membrane ; Single-pass membrane protein .
Tissue Specificity Highest level in polymorphonuclear leukocytes and dendritic cells. Detectable in lymph nodes, spleen, bone marrow and peripheral blood. Highly expressed in ovary. Very low level in liver, kidney, and smooth muscle.

Identical and Related Proteins

Unique RefSeq proteins for LMP003838 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
251823870 RefSeq NP_077764 524 leukotriene-B(4) omega-hydroxylase 2 precursor

Identical Sequences to LMP003838 proteins

Reference Database Accession Length Protein Name
GI:251823870 RefSeq XP_006509811.1 524 PREDICTED: leukotriene-B(4) omega-hydroxylase 2 isoform X1 [Mus musculus]
GI:251823870 SwissProt Q99N16.2 524 RecName: Full=Leukotriene-B(4) omega-hydroxylase 2; AltName: Full=CYPIVF3; AltName: Full=Cytochrome P450 4F3; AltName: Full=Cytochrome P450-LTB-omega; AltName: Full=Leukotriene-B(4) 20-monooxygenase 2 [Mus musculus]

Related Sequences to LMP003838 proteins

Reference Database Accession Length Protein Name
GI:251823870 DBBJ BAB25315.1 524 unnamed protein product [Mus musculus]
GI:251823870 GenBank AAK15013.1 524 cytochrome P450 CYP4F18 [Mus musculus]
GI:251823870 GenBank AAH13494.1 524 Cytochrome P450, family 4, subfamily f, polypeptide 18 [Mus musculus]
GI:251823870 GenBank AAI01919.1 524 Cytochrome P450, family 4, subfamily f, polypeptide 18 [Rattus norvegicus]
GI:251823870 RefSeq NP_001028858.1 524 leukotriene-B(4) omega-hydroxylase 2 [Rattus norvegicus]
GI:251823870 SwissProt Q3MID2.1 524 RecName: Full=Leukotriene-B(4) omega-hydroxylase 2; AltName: Full=CYPIVF3; AltName: Full=Cytochrome P450 4F3; AltName: Full=Cytochrome P450-LTB-omega; AltName: Full=Leukotriene-B(4) 20-monooxygenase 2 [Rattus norvegicus]