Gene/Proteome Database (LMPD)
Proteins
| serine incorporator 1 precursor | |
|---|---|
| Refseq ID | NP_062734 |
| Protein GI | 9790269 |
| UniProt ID | Q9QZI8 |
| mRNA ID | NM_019760 |
| Length | 453 |
| RefSeq Status | VALIDATED |
| MGSVLGLCSVASWIPCLCGSAPCLLCRCCPSGNNSTVTRLIYALFLLVGVCVACVMLIPGMEEQLNKIPGFCENEKGVVPCNILVGYKAVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFATAVAIIIGAFFIPEGTFTTVWFYVGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNYLLSLVAVVLFFVYYTHPASCAENKAFISVNMLLCIGASVMSILPKIQESQPRSGLLQSSVITVYTMYLTWSAMTNEPETNCNPSLLSIIGFNTTRPIPKDGQSVQWWHPQGIIGLVLFLLCVFYSSIRTSNNSQVNKLTLTSDESTLIEDGNGRSDGSLDDGDGIHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPSREMKSQWTAVWVKISSSWIGLVLYVWTLVAPLVLTNRDFD | |
| sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1896 peptide sequence: MGSVLGLCSVASWIPCLCG | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | IEA:Ensembl | C | endoplasmic reticulum membrane |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0005886 | IDA:MGI | C | plasma membrane |
| GO:0015194 | IEA:Ensembl | F | L-serine transmembrane transporter activity |
| GO:0006658 | IEA:Ensembl | P | phosphatidylserine metabolic process |
| GO:0051347 | IEA:Ensembl | P | positive regulation of transferase activity |
| GO:0006665 | IEA:Ensembl | P | sphingolipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP003653 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 9790269 | RefSeq | NP_062734 | 453 | serine incorporator 1 precursor |
Identical Sequences to LMP003653 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:9790269 | DBBJ | BAE24743.1 | 453 | unnamed protein product [Mus musculus] |
| GI:9790269 | DBBJ | BAE28654.1 | 453 | unnamed protein product [Mus musculus] |
| GI:9790269 | DBBJ | BAE21775.1 | 453 | unnamed protein product [Mus musculus] |
| GI:9790269 | DBBJ | BAE21964.1 | 453 | unnamed protein product [Mus musculus] |
| GI:9790269 | DBBJ | BAF94204.1 | 453 | axotomy induced glycoprotein 2 [Mus musculus] |
| GI:9790269 | GenBank | EDL05118.1 | 453 | serine incorporator 1, isoform CRA_c [Mus musculus] |
Related Sequences to LMP003653 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:9790269 | GenBank | AAQ17069.1 | 453 | tumor differentially expressed 1-like protein [Rattus norvegicus] |
| GI:9790269 | GenBank | AAH88852.1 | 453 | Serinc1 protein [Rattus norvegicus] |
| GI:9790269 | GenBank | AAZ80295.1 | 453 | serine incorporator 1 [Rattus norvegicus] |
| GI:9790269 | GenBank | EDL92897.1 | 453 | serine incorporator 1, isoform CRA_b [Rattus norvegicus] |
| GI:9790269 | RefSeq | NP_891996.1 | 453 | serine incorporator 1 precursor [Rattus norvegicus] |
| GI:9790269 | SwissProt | Q7TNK0.1 | 453 | RecName: Full=Serine incorporator 1; AltName: Full=Tumor differentially expressed protein 1-like; AltName: Full=Tumor differentially expressed protein 2 [Rattus norvegicus] |