Gene/Proteome Database (LMPD)

LMPD ID
LMP003456
Gene ID
55824
Species
Homo sapiens (Human)
Gene Name
phosphoprotein membrane anchor with glycosphingolipid microdomains 1
Gene Symbol
PAG1
Synonyms
CBP; PAG
Alternate Names
phosphoprotein associated with glycosphingolipid-enriched microdomains 1; Csk-binding protein; transmembrane phosphoprotein Cbp; transmembrane adapter protein PAG; transmembrane adaptor protein PAG; phosphoprotein associated with glycosphingolipid microdomains 1
Chromosome
8
Map Location
8q21.13
Summary
The protein encoded by this gene is a type III transmembrane adaptor protein that binds to the tyrosine kinase csk protein. It is thought to be involved in the regulation of T cell activation. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for PAG1

Proteins

phosphoprotein associated with glycosphingolipid-enriched microdomains 1
Refseq ID NP_060910
Protein GI 63054864
UniProt ID Q9NWQ8
mRNA ID NM_018440
Length 432
RefSeq Status REVIEWED
MGPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRL

Gene Information

Entrez Gene ID
55824
Gene Name
phosphoprotein membrane anchor with glycosphingolipid microdomains 1
Gene Symbol
PAG1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0045121 IDA:HGNC C membrane raft
GO:0005886 IDA:HGNC C plasma membrane
GO:0042169 IDA:HGNC F SH2 domain binding
GO:0005070 NAS:HGNC F SH3/SH2 adaptor activity
GO:0050852 TAS:Reactome P T cell receptor signaling pathway
GO:0007173 TAS:Reactome P epidermal growth factor receptor signaling pathway
GO:0035556 IDA:HGNC P intracellular signal transduction
GO:0050868 IEA:Ensembl P negative regulation of T cell activation
GO:0009967 NAS:GOC P positive regulation of signal transduction
GO:0050863 IDA:ProtInc P regulation of T cell activation
GO:0007165 TAS:ProtInc P signal transduction

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_75774 Adaptive Immune System
REACT_116125 Disease
REACT_12578 GAB1 signalosome
REACT_6900 Immune System
REACT_12582 Phosphorylation of CD3 and TCR zeta chains
REACT_111102 Signal Transduction
REACT_9417 Signaling by EGFR
REACT_115871 Signaling by EGFR in Cancer
REACT_12526 TCR signaling

Domain Information

InterPro Annotations

Accession Description

UniProt Annotations

Entry Information

Gene Name
phosphoprotein membrane anchor with glycosphingolipid microdomains 1
Protein Entry
PHAG1_HUMAN
UniProt ID
Q9NWQ8
Species
Human

Comments

Comment Type Description
Function Negatively regulates TCR (T-cell antigen receptor)- mediated signaling in T-cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Promotes CSK activation and recruitment to lipid rafts, which results in LCK inhibition. Inhibits immunological synapse formation by preventing dynamic arrangement of lipid raft proteins. May be involved in cell adhesion signaling.
Function Negatively regulates TCR (T-cell antigen receptor)- mediated signaling in T-cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Promotes CSK activation and recruitment to lipid rafts, which results in LCK inhibition. Inhibits immunological synapse formation by preventing dynamic arrangement of lipid raft proteins. May be involved in cell adhesion signaling. {ECO:0000269|PubMed:10790433}.
Interaction P06241:FYN; NbExp=5; IntAct=EBI-2828115, EBI-515315; P63244:GNB2L1; NbExp=2; IntAct=EBI-2828115, EBI-296739; P07948:LYN; NbExp=3; IntAct=EBI-2828115, EBI-79452;
Ptm Palmitoylated.
Ptm Palmitoylated. {ECO:0000269|PubMed:10790433}.
Ptm Phosphorylated by FYN on Tyr-317 in resting T-cells; which promotes interaction with CSK. Dephosphorylated by PTPRC/CD45 upon TCR activation; which leads to CSK dissociation. May also be dephosphorylated by PTPN11. Hyperphosphorylated in mast cells upon FCER1 activation. Phosphorylated by LYN. {ECO
Ptm Phosphorylated by FYN on Tyr-317 in resting T-cells; which promotes interaction with CSK. Dephosphorylated by PTPRC/CD45 upon TCR activation; which leads to CSK dissociation. May also be dephosphorylated by PTPN11. Hyperphosphorylated in mast cells upon FCER1 activation. Phosphorylated by LYN. {ECO:0000269|PubMed:10790433, ECO:0000269|PubMed:18070987, ECO:0000269|PubMed:19690332}.
Subcellular Location Cell membrane {ECO
Subcellular Location Cell membrane {ECO:0000269|PubMed:10790433, ECO:0000269|PubMed:18070987}; Single-pass type III membrane protein {ECO:0000269|PubMed:10790433, ECO:0000269|PubMed:18070987}. Note=Present in lipid rafts.
Subunit Interacts with FYN. When phosphorylated, interacts with CSK. Interacts with SLC9A3R1/EBP50. In resting T-cells, part of a PAG1-SLC9A3R1-MSN complex which is disrupted upon TCR activation. Interacts with LYN on plasma membrane lipid rafts. Identified in a complex with LYN and STAT3. {ECO
Subunit Interacts with FYN. When phosphorylated, interacts with CSK. Interacts with SLC9A3R1/EBP50. In resting T-cells, part of a PAG1-SLC9A3R1-MSN complex which is disrupted upon TCR activation. Interacts with LYN on plasma membrane lipid rafts. Identified in a complex with LYN and STAT3. {ECO:0000269|PubMed:10790433, ECO:0000269|PubMed:11684085, ECO:0000269|PubMed:18070987}.
Tissue Specificity Ubiquitously expressed. Present in germinal center B-cells, plasma cells, T-cells, monocytes and platelets (at protein level). {ECO
Tissue Specificity Ubiquitously expressed. Present in germinal center B-cells, plasma cells, T-cells, monocytes and platelets (at protein level). {ECO:0000269|PubMed:10790433, ECO:0000269|PubMed:16160011}.

Identical and Related Proteins

Unique RefSeq proteins for LMP003456 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
63054864 RefSeq NP_060910 432 phosphoprotein associated with glycosphingolipid-enriched microdomains 1

Identical Sequences to LMP003456 proteins

Reference Database Accession Length Protein Name
GI:63054864 DBBJ BAF82507.1 432 unnamed protein product [Homo sapiens]
GI:63054864 DBBJ BAI45718.1 432 phosphoprotein associated with glycosphingolipid microdomains 1, partial [synthetic construct]
GI:63054864 GenBank EAW87086.1 432 phosphoprotein associated with glycosphingolipid microdomains 1, isoform CRA_b [Homo sapiens]
GI:63054864 GenBank ACM81967.1 432 Sequence 7465 from patent US 6812339
GI:63054864 RefSeq XP_006716524.1 432 PREDICTED: phosphoprotein associated with glycosphingolipid-enriched microdomains 1 isoform X1 [Homo sapiens]
GI:63054864 RefSeq XP_006716525.1 432 PREDICTED: phosphoprotein associated with glycosphingolipid-enriched microdomains 1 isoform X2 [Homo sapiens]

Related Sequences to LMP003456 proteins

Reference Database Accession Length Protein Name
GI:63054864 DBBJ BAA91321.1 432 unnamed protein product [Homo sapiens]
GI:63054864 GenBank AAH90931.1 432 Phosphoprotein associated with glycosphingolipid microdomains 1 [Homo sapiens]
GI:63054864 GenBank ACE86824.1 432 phosphoprotein associated with glycosphingolipid microdomains 1 protein, partial [synthetic construct]
GI:63054864 GenBank ACE87510.1 432 phosphoprotein associated with glycosphingolipid microdomains 1 protein [synthetic construct]
GI:63054864 GenBank AED17588.1 432 Sequence 3004 from patent US 7879556
GI:63054864 GenBank AED47915.1 432 Sequence 3004 from patent US 7892745