Gene/Proteome Database (LMPD)

LMPD ID
LMP003048
Gene ID
Species
Mus musculus (Mouse)
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta)
Gene Symbol
Synonyms
1500003P24Rik
Alternate Names
1-acyl-sn-glycerol-3-phosphate acyltransferase delta; 1-AGPAT 4; LPAAT-delta; 1-AGP acyltransferase 4; lysophosphatidic acid acyltransferase delta; lysophosphatidic acid acyltransferase-delta; 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, delta)
Chromosome
17
Map Location
17|17 A2
EC Number
2.3.1.51

Proteins

1-acyl-sn-glycerol-3-phosphate acyltransferase delta
Refseq ID NP_080920
Protein GI 27229064
UniProt ID Q8K4X7
mRNA ID NM_026644
Length 378
RefSeq Status PROVISIONAL
MDLIGLLKSQFLCHLVFCYVFIASGLIVNAIQLCTLVIWPINKQLFRKINARLCYCVSSQLVMLLEWWSGTECTIYTDPKACPHYGKENAIVVLNHKFEIDFLCGWSLAERLGILGNSKVLAKKELAYVPIIGWMWYFVEMIFCTRKWEQDRQTVAKSLLHLRDYPEKYLFLIHCEGTRFTEKKHQISMQVAQAKGLPSLKHHLLPRTKGFAITVKCLRDVVPAVYDCTLNFRNNENPTLLGVLNGKKYHADCYVRRIPMEDIPEDEDKCSAWLHKLYQEKDAFQEEYYRTGVFPETPWVPPRRPWSLVNWLFWASLLLYPFFQFLVSMVSSGSSVTLASLVLIFCMASMGVRWMIGVTEIDKGSAYGNIDNKRKQTD

Gene Information

Entrez Gene ID
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta)
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003841 IEA:UniProtKB-EC F 1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0016024 IEA:UniProtKB-UniPathway P CDP-diacylglycerol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00561 Glycerolipid metabolism
mmu00564 Glycerophospholipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5892982 Synthesis of PA

Domain Information

InterPro Annotations

Accession Description
IPR002123 Phospholipid/glycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta)
Protein Entry
PLCD_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate.
Domain The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. {ECO:0000250}.
Function Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. {ECO:0000269|PubMed:15367102}.
Pathway Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3.
Similarity Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.
Tissue Specificity Expressed at a high levels in the brain, at intermediate or low levels in skeletal muscles, gut, kidney, spleen and lung. Barely detectable in heart and liver. {ECO:0000269|PubMed:15367102}.

Identical and Related Proteins

Unique RefSeq proteins for LMP003048 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
27229064 RefSeq NP_080920 378 1-acyl-sn-glycerol-3-phosphate acyltransferase delta

Identical Sequences to LMP003048 proteins

Reference Database Accession Length Protein Name
GI:27229064 DBBJ BAB23837.2 378 unnamed protein product [Mus musculus]
GI:27229064 DBBJ BAE39115.1 378 unnamed protein product [Mus musculus]
GI:27229064 GenBank AAM33375.1 378 lysophosphatidic acid acyltransferase-delta [Mus musculus]
GI:27229064 GenBank AAH47281.1 378 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Mus musculus]
GI:27229064 SwissProt Q8K4X7.1 378 RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase delta; AltName: Full=1-acylglycerol-3-phosphate O-acyltransferase 4; Short=1-AGP acyltransferase 4; Short=1-AGPAT 4; AltName: Full=Lysophosphatidic acid acyltransferase delta; Short=LPAAT-delta [Mus musculus]

Related Sequences to LMP003048 proteins

Reference Database Accession Length Protein Name
GI:27229064 GenBank AAH86992.1 378 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Rattus norvegicus]
GI:27229064 GenBank EDL02075.1 378 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, delta), isoform CRA_a [Mus musculus]
GI:27229064 GenBank EDL02076.1 378 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, delta), isoform CRA_a [Mus musculus]
GI:27229064 RefSeq XP_006227919.1 378 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta isoform X1 [Rattus norvegicus]
GI:27229064 RefSeq XP_006523408.1 472 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta isoform X1 [Mus musculus]
GI:27229064 RefSeq XP_006523409.1 448 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta isoform X2 [Mus musculus]