Gene/Proteome Database (LMPD)
LMPD ID
LMP002811
Gene ID
Species
Mus musculus (Mouse)
Gene Name
sphingosine-1-phosphate receptor 1
Gene Symbol
Synonyms
AI849002; Edg1; Lpb1; S1p; S1p1
Alternate Names
sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P receptor Edg-1; lysophospholipid receptor B1; sphingosine 1-phosphate receptor Edg-1; endothelial differentiation G-protein coupled receptor 1; endothelial differentiation sphingolipid G-protein-coupled receptor 1
Chromosome
3
Map Location
3 G1|3
Summary
This gene encodes a G-protein-coupled receptor bound by the lysophospholipid, sphingosine 1-phosphate. The gene product functions in endothelial cells and is involved in vascular and heart development. This receptor is highly expressed in T and B lymphocytes, and it plays a role in T cell and B cell export from peripheral lymphoid organs. This protein is bound and downregulated by FTY720, an exogenous immunosuppressant drug studied in mouse disease models for multiple sclerosis in humans. [provided by RefSeq, Jan 2010]
Orthologs
Proteins
| sphingosine 1-phosphate receptor 1 | |
|---|---|
| Refseq ID | NP_031927 |
| Protein GI | 21687214 |
| UniProt ID | O08530 |
| mRNA ID | NM_007901 |
| Length | 382 |
| RefSeq Status | REVIEWED |
| MVSTSIPEVKALRSSVSDYGNYDIIVRHYNYTGKLNIGAEKDHGIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPIMGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIVSCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSSHPQKDDGDNPETIMSSGNVNSSS | |
Gene Information
Entrez Gene ID
Gene Name
sphingosine-1-phosphate receptor 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005768 | IEA:UniProtKB-KW | C | endosome |
| GO:0009897 | IMP:MGI | C | external side of plasma membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0031226 | ISS:UniProtKB | C | intrinsic component of plasma membrane |
| GO:0046625 | IEA:Ensembl | F | sphingolipid binding |
| GO:0038036 | IMP:UniProtKB | F | sphingosine-1-phosphate receptor activity |
| GO:0072678 | IMP:UniProtKB | P | T cell migration |
| GO:0031532 | IMP:UniProtKB | P | actin cytoskeleton reorganization |
| GO:0007193 | IDA:MGI | P | adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway |
| GO:0001525 | IDA:MGI | P | angiogenesis |
| GO:0001955 | IMP:UniProtKB | P | blood vessel maturation |
| GO:0007420 | IMP:MGI | P | brain development |
| GO:0003245 | IMP:UniProtKB | P | cardiac muscle tissue growth involved in heart morphogenesis |
| GO:0016477 | IMP:UniProtKB | P | cell migration |
| GO:0006935 | IMP:UniProtKB | P | chemotaxis |
| GO:0045446 | IEA:Ensembl | P | endothelial cell differentiation |
| GO:0061384 | IMP:UniProtKB | P | heart trabecula morphogenesis |
| GO:0030032 | IMP:UniProtKB | P | lamellipodium assembly |
| GO:0051497 | IEA:Ensembl | P | negative regulation of stress fiber assembly |
| GO:0030182 | IEA:Ensembl | P | neuron differentiation |
| GO:0032320 | IEA:Ensembl | P | positive regulation of Ras GTPase activity |
| GO:0030335 | IEA:Ensembl | P | positive regulation of cell migration |
| GO:0008284 | IMP:MGI | P | positive regulation of cell proliferation |
| GO:0051482 | IEA:Ensembl | P | positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway |
| GO:0050927 | IEA:Ensembl | P | positive regulation of positive chemotaxis |
| GO:0048661 | IEA:Ensembl | P | positive regulation of smooth muscle cell proliferation |
| GO:0045944 | IEA:Ensembl | P | positive regulation of transcription from RNA polymerase II promoter |
| GO:0030500 | IMP:UniProtKB | P | regulation of bone mineralization |
| GO:0045124 | IMP:UniProtKB | P | regulation of bone resorption |
| GO:0030155 | IDA:MGI | P | regulation of cell adhesion |
| GO:0003376 | IMP:UniProtKB | P | sphingosine-1-phosphate signaling pathway |
| GO:0019226 | IEA:Ensembl | P | transmission of nerve impulse |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu04068 | FoxO signaling pathway |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5893663 | G alpha (i) signalling events |
Domain Information
UniProt Annotations
Entry Information
Gene Name
sphingosine-1-phosphate receptor 1
Protein Entry
S1PR1_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Disruption Phenotype | Embryonic lethality, due to impaired vascular maturation and defects in heart development. Embryos appear normal up to 11.5 dpc, but after that they display massive hemorrhage. They have a normally arborized vascular network, but present excessive sprouting angiogenesis and severe aberrations in vessel size. Their aorta and other arteries are not properly enveloped by vascular smooth muscle cells, causing hemorrhage. Likewise, small blood vessels show a marked reduction in the number of vascular pericytes. In addition, mutants display defects in heart morphogenesis, with reduced myocardial tissue and altered morphology of the heart wall and the trabeculae. Conditional knockout in endothelial cells leads to the same vascular maturation defect as that seen in homozygous knockout mice. Conditional knockout in fibroblasts leads to defects in chemotaxis, probably due to defects in the activation of SRC and PTK2/FAK1, resulting in defects in the reorganization of the actin cytoskeleton and lamellipodia formation. A T-cell-specific knockout leads to a defect in the egress of mature T-cells from the thymus into the periphery. Conditional knockout in osteoclast precursors leads to osteoporosis, due to impaired migration of osteoclast precursors and increased osteoclast attachment to the bone. {ECO:0000269|PubMed:11032855, ECO:0000269|PubMed:11726541, ECO:0000269|PubMed:12869509, ECO:0000269|PubMed:14732704, ECO:0000269|PubMed:14737169, ECO:0000269|PubMed:19204730, ECO:0000269|PubMed:21668976, ECO:0000269|PubMed:22951644}. |
| Function | G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis. Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury. {ECO:0000269|PubMed:11032855, ECO:0000269|PubMed:11230698, ECO:0000269|PubMed:11726541, ECO:0000269|PubMed:12869509, ECO:0000269|PubMed:14732704, ECO:0000269|PubMed:14737169, ECO:0000269|PubMed:19204730, ECO:0000269|PubMed:19286607, ECO:0000269|PubMed:21668976, ECO:0000269|PubMed:22951644}. |
| Similarity | Belongs to the G-protein coupled receptor 1 family. {ECO:0000255|PROSITE-ProRule:PRU00521}. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. Endosome {ECO:0000250}. Membrane, caveola {ECO:0000250}. Note=Recruited to caveolin-enriched plasma membrane microdomains in response to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3- phosphocholine. Ligand binding leads to receptor internalization (By similarity). {ECO:0000250}. |
| Subunit | Interacts with GNAI1 and GNAI3. {ECO:0000250}. |
| Tissue Specificity | Expressed in a wide variety of tissues with highest levels in brain, heart and spleen. Lower levels found in kidney, liver, lung, muscle, placenta, thymus, and uterus. Very low levels in intestine, stomach and testis. According to PubMed:9931453, expressed modestly in apparent endothelial cells surrounding some blood vessels (e.g. aortic trunk). {ECO:0000269|PubMed:11032855, ECO:0000269|PubMed:9931453}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002811 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 21687214 | RefSeq | NP_031927 | 382 | sphingosine 1-phosphate receptor 1 |
Identical Sequences to LMP002811 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21687214 | DBBJ | BAE27216.1 | 382 | unnamed protein product [Mus musculus] |
| GI:21687214 | GenBank | AAH49094.1 | 382 | Sphingosine-1-phosphate receptor 1 [Mus musculus] |
| GI:21687214 | GenBank | AAH51023.1 | 382 | Sphingosine-1-phosphate receptor 1 [Mus musculus] |
| GI:21687214 | GenBank | EDL12402.1 | 382 | endothelial differentiation sphingolipid G-protein-coupled receptor 1 [Mus musculus] |
| GI:21687214 | GenBank | AED45321.1 | 382 | Sequence 783 from patent US 7892730 |
| GI:21687214 | SwissProt | O08530.3 | 382 | RecName: Full=Sphingosine 1-phosphate receptor 1; Short=S1P receptor 1; Short=S1P1; AltName: Full=Endothelial differentiation G-protein coupled receptor 1; AltName: Full=Lysophospholipid receptor B1; AltName: Full=Sphingosine 1-phosphate receptor Edg-1; Short=S1P receptor Edg-1; AltName: CD_antigen=CD363 [Mus musculus] |
Related Sequences to LMP002811 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21687214 | DBBJ | BAE23622.1 | 382 | unnamed protein product [Mus musculus] |
| GI:21687214 | GenBank | AAC53294.1 | 382 | orphan G-protein-coupled receptor [Mus musculus] |
| GI:21687214 | GenBank | AAD16975.1 | 382 | lysophospholipid receptor B1 [Mus musculus] |
| GI:21687214 | GenBank | AEF78471.1 | 382 | Sequence 26 from patent US 7943732 |
| GI:21687214 | GenBank | AFS96219.1 | 382 | Sequence 26 from patent US 8263357 |
| GI:21687214 | GenBank | AFX82592.1 | 382 | sphingosine 1-phosphate receptor 1 [Mus musculus] |