Gene/Proteome Database (LMPD)

LMPD ID
LMP002755
Gene ID
22287
Species
Mus musculus (Mouse)
Gene Name
secretoglobin, family 1A, member 1 (uteroglobin)
Gene Symbol
Scgb1a1
Synonyms
CC10; CC16; CCSP; PCB-BP; UG; UGB; Utg
Alternate Names
uteroglobin; CCPBP; Blastokinin; PCB-binding protein; clara cell 17 kDa protein; clara cell secretory protein; secretoglobin family 1A member 1; clara cells 10 kDa secretory protein; clara cell phospholipid-binding protein
Chromosome
19
Map Location
19 A|19

Proteins

uteroglobin precursor
Refseq ID NP_035811
Protein GI 6755947
UniProt ID Q06318
mRNA ID NM_011681
Length 96
RefSeq Status VALIDATED
MKIAITITVVMLSICCSSASSDICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF
sig_peptide: 1..21 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (Q06318.1) calculated_mol_wt: 2159 peptide sequence: MKIAITITVVMLSICCSSASS mat_peptide: 22..96 product: Uteroglobin experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q06318.1) calculated_mol_wt: 8379 peptide sequence: DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Gene Information

Entrez Gene ID
22287
Gene Name
secretoglobin, family 1A, member 1 (uteroglobin)
Gene Symbol
Scgb1a1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:MGI C cytoplasm
GO:0005615 IEA:Ensembl C extracellular space
GO:0005622 IDA:MGI C intracellular
GO:0005635 IEA:Ensembl C nuclear envelope
GO:0005791 IEA:Ensembl C rough endoplasmic reticulum
GO:0030141 IEA:Ensembl C secretory granule
GO:0019834 IEA:UniProtKB-KW F phospholipase A2 inhibitor activity
GO:0042130 IDA:MGI P negative regulation of T cell proliferation
GO:0032689 IDA:MGI P negative regulation of interferon-gamma production
GO:0032696 IDA:MGI P negative regulation of interleukin-13 production
GO:0032713 IDA:MGI P negative regulation of interleukin-4 production
GO:0032714 IDA:MGI P negative regulation of interleukin-5 production
GO:0000122 IDA:MGI P negative regulation of transcription from RNA polymerase II promoter
GO:0050727 IDA:MGI P regulation of inflammatory response
GO:0043488 IDA:MGI P regulation of mRNA stability
GO:0034097 IEA:Ensembl P response to cytokine
GO:0042493 IEA:Ensembl P response to drug
GO:0071774 IEA:Ensembl P response to fibroblast growth factor
GO:0051384 IEA:Ensembl P response to glucocorticoid
GO:0032496 IEA:Ensembl P response to lipopolysaccharide
GO:0010193 IEA:Ensembl P response to ozone
GO:0034021 IEA:Ensembl P response to silicon dioxide
GO:0009410 IEA:Ensembl P response to xenobiotic stimulus

Domain Information

InterPro Annotations

Accession Description
IPR016126 Secretoglobin
IPR000329 Uteroglobin

UniProt Annotations

Entry Information

Gene Name
secretoglobin, family 1A, member 1 (uteroglobin)
Protein Entry
UTER_MOUSE
UniProt ID
Q06318
Species
Mouse

Comments

Comment Type Description
Developmental Stage Appears on the eighteenth day of gestation in the airway epithelium.
Function Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2.
Induction By glucocorticoids.
Similarity Belongs to the secretoglobin family. {ECO:0000305}.
Subcellular Location Secreted.
Subunit Homodimer; antiparallel disulfide-linked.
Tissue Specificity Clara cells (nonciliated cells of the surface epithelium of the pulmonary airways).

Identical and Related Proteins

Unique RefSeq proteins for LMP002755 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6755947 RefSeq NP_035811 96 uteroglobin precursor

Identical Sequences to LMP002755 proteins

Reference Database Accession Length Protein Name
GI:6755947 DBBJ BAE26692.1 96 unnamed protein product [Mus musculus]
GI:6755947 GenBank AAA03625.1 96 uteroglobin [Mus musculus]
GI:6755947 GenBank AAA65446.1 96 Clara cell secretory protein [Mus musculus]
GI:6755947 GenBank AAH27518.1 96 Secretoglobin, family 1A, member 1 (uteroglobin) [Mus musculus]
GI:6755947 GenBank EDL33415.1 96 secretoglobin, family 1A, member 1 (uteroglobin) [Mus musculus]
GI:6755947 SwissProt Q06318.1 96 RecName: Full=Uteroglobin; AltName: Full=Clara cell 17 kDa protein; AltName: Full=Clara cell phospholipid-binding protein; Short=CCPBP; AltName: Full=Clara cells 10 kDa secretory protein; Short=CC10; AltName: Full=PCB-binding protein; AltName: Full=Secretoglobin family 1A member 1; Flags: Precursor [Mus musculus]

Related Sequences to LMP002755 proteins

Reference Database Accession Length Protein Name
GI:6755947 GenBank AAA41817.1 96 PCB binding protein precursor [Rattus norvegicus]
GI:6755947 GenBank EDM12772.1 96 secretoglobin, family 1A, member 1 (uteroglobin) [Rattus norvegicus]
GI:6755947 PDB 1UTR 96 Chain A, Uteroglobin-Pcb Complex (Reduced Form)
GI:6755947 PDB 1UTR 96 Chain B, Uteroglobin-Pcb Complex (Reduced Form)
GI:6755947 PIR - 113 cell specific 10K protein - mouse [Mus musculus]
GI:6755947 SwissProt P17559.2 96 RecName: Full=Uteroglobin; AltName: Full=Clara cell phospholipid-binding protein; Short=CCPBP; AltName: Full=Clara cells 10 kDa secretory protein; Short=CC10; AltName: Full=PCB-binding protein; AltName: Full=Secretoglobin family 1A member 1; Flags: Precursor [Rattus norvegicus]