Gene/Proteome Database (LMPD)

LMPD ID
LMP002625
Gene ID
2170
Species
Homo sapiens (Human)
Gene Name
fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor)
Gene Symbol
FABP3
Synonyms
FABP11; H-FABP; M-FABP; MDGI; O-FABP
Alternate Names
fatty acid-binding protein, heart; fatty acid binding protein 11; mammary-derived growth inhibitor; muscle fatty acid-binding protein; Fatty acid-binding protein 3, muscle; heart-type fatty acid-binding protein
Chromosome
1
Map Location
1p33-p32
Summary
The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for FABP3

Proteins

fatty acid-binding protein, heart
Refseq ID NP_004093
Protein GI 4758328
UniProt ID P05413
mRNA ID NM_004102
Length 133
RefSeq Status REVIEWED
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Gene Information

Entrez Gene ID
2170
Gene Name
fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor)
Gene Symbol
FABP3
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 TAS:BHF-UCL C cytosol
GO:0005615 IDA:UniProt C extracellular space
GO:0070062 IDA:UniProtKB C extracellular vesicular exosome
GO:0016528 IEA:Ensembl C sarcoplasm
GO:0008092 IPI:UniProtKB F cytoskeletal protein binding
GO:0050543 IEA:Ensembl F icosatetraenoic acid binding
GO:0036041 IDA:BHF-UCL F long-chain fatty acid binding
GO:0005324 IEA:Ensembl F long-chain fatty acid transporter activity
GO:0070538 IDA:BHF-UCL F oleic acid binding
GO:0042632 ISS:BHF-UCL P cholesterol homeostasis
GO:0006631 IEA:Ensembl P fatty acid metabolic process
GO:0044539 ISS:BHF-UCL P long-chain fatty acid import
GO:0008285 TAS:ProtInc P negative regulation of cell proliferation
GO:0055091 ISS:BHF-UCL P phospholipid homeostasis
GO:0071073 IC:BHF-UCL P positive regulation of phospholipid biosynthetic process
GO:0046320 ISS:BHF-UCL P regulation of fatty acid oxidation
GO:0042493 IEA:Ensembl P response to drug
GO:0070542 IEA:Ensembl P response to fatty acid
GO:0032868 IEA:Ensembl P response to insulin

KEGG Pathway Links

KEGG Pathway ID Description
hsa03320 PPAR signaling pathway
ko03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor)
Protein Entry
FABPH_HUMAN
UniProt ID
P05413
Species
Human

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
Function FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Interaction P05556:ITGB1; NbExp=2; IntAct=EBI-704216, EBI-703066;
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Subcellular Location Cytoplasm.

Identical and Related Proteins

Unique RefSeq proteins for LMP002625 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4758328 RefSeq NP_004093 133 fatty acid-binding protein, heart

Identical Sequences to LMP002625 proteins

Reference Database Accession Length Protein Name
GI:4758328 GenBank JAA37112.1 133 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) [Pan troglodytes]
GI:4758328 GenBank AHD74541.1 133 Sequence 14558 from patent US 8586006
GI:4758328 GenBank AIC48731.1 133 FABP3, partial [synthetic construct]
GI:4758328 PDB 3WXQ 133 Chain A, Serial Femtosecond X-ray Structure Of Human Fatty Acid-binding Protein Type-3 (fabp3) In Complex With Stearic Acid (c18:0) Determined Using X-ray Free-electron Laser At Sacla
GI:4758328 RefSeq XP_004025387.1 133 PREDICTED: fatty acid-binding protein, heart isoform 1 [Gorilla gorilla gorilla]
GI:4758328 RefSeq XP_004025388.1 133 PREDICTED: fatty acid-binding protein, heart isoform 2 [Gorilla gorilla gorilla]

Related Sequences to LMP002625 proteins

Reference Database Accession Length Protein Name
GI:4758328 GenBank EOS46596.1 56 hypothetical protein C809_02628 [Lachnospiraceae bacterium COE1]
GI:4758328 GenBank EPE85124.1 46 hypothetical protein LEP1GSC021_0090 [Leptospira noguchii str. 1993005606]
GI:4758328 gnl AORICAS 845 hypothetical protein AORI_5460 [Amycolatopsis orientalis HCCB10007]
GI:4758328 gnl REF_AORICAS 845 hypothetical protein AORI_5460 [Amycolatopsis orientalis HCCB10007]
GI:4758328 RefSeq WP_016335783.1 845 hypothetical protein [Amycolatopsis orientalis]
GI:4758328 RefSeq WP_016559314.1 46 hypothetical protein [Leptospira noguchii]