Gene/Proteome Database (LMPD)
Proteins
| group IIE secretory phospholipase A2 precursor | |
|---|---|
| Refseq ID | NP_055404 |
| Protein GI | 7657461 |
| UniProt ID | Q9NZK7 |
| mRNA ID | NM_014589 |
| Length | 142 |
| RefSeq Status | VALIDATED |
| MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC | |
| sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2041 peptide sequence: MKSPHVLVFLCLLVALVTG mat_peptide: 20..142 product: Group IIE secretory phospholipase A2 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9NZK7.1) calculated_mol_wt: 13966 peptide sequence: NLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | TAS:Reactome | C | extracellular region |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0004623 | TAS:ProtInc | F | phospholipase A2 activity |
| GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
| GO:0006954 | TAS:ProtInc | P | inflammatory response |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
| GO:0006654 | TAS:Reactome | P | phosphatidic acid biosynthetic process |
| GO:0036151 | TAS:Reactome | P | phosphatidylcholine acyl-chain remodeling |
| GO:0036152 | TAS:Reactome | P | phosphatidylethanolamine acyl-chain remodeling |
| GO:0036148 | TAS:Reactome | P | phosphatidylglycerol acyl-chain remodeling |
| GO:0036149 | TAS:Reactome | P | phosphatidylinositol acyl-chain remodeling |
| GO:0036150 | TAS:Reactome | P | phosphatidylserine acyl-chain remodeling |
| GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO |
| Cofactor | Name=Ca(2+); Xref=ChEBI |
| Function | PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Has a preference for arachidonic-containing phospholipids. |
| Similarity | Belongs to the phospholipase A2 family. |
| Subcellular Location | Secreted. |
| Tissue Specificity | Restricted to the brain, heart, lung, and placenta. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002556 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 7657461 | RefSeq | NP_055404 | 142 | group IIE secretory phospholipase A2 precursor |
Identical Sequences to LMP002556 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7657461 | DBBJ | BAG73531.1 | 142 | phospholipase A2, group IIE, partial [synthetic construct] |
| GI:7657461 | GenBank | AAY07212.1 | 142 | Sequence 30 from patent US 6872557 |
| GI:7657461 | GenBank | AAI41620.1 | 142 | Phospholipase A2, group IIE [synthetic construct] |
| GI:7657461 | GenBank | AAI40241.1 | 142 | Phospholipase A2, group IIE, partial [synthetic construct] |
| GI:7657461 | GenBank | AEU43365.1 | 142 | Sequence 114 from patent US 8052970 |
| GI:7657461 | GenBank | AGF22441.1 | 142 | Sequence 7 from patent US 8372594 |
Related Sequences to LMP002556 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7657461 | GenBank | AAH69116.1 | 140 | PLA2G2E protein, partial [Homo sapiens] |
| GI:7657461 | GenBank | AAW12532.1 | 154 | Sequence 8 from patent US 6812017 |
| GI:7657461 | GenBank | EAW94906.1 | 154 | phospholipase A2, group IIE [Homo sapiens] |
| GI:7657461 | RefSeq | XP_003891294.1 | 142 | PREDICTED: group IIE secretory phospholipase A2 [Papio anubis] |
| GI:7657461 | RefSeq | XP_004024859.1 | 142 | PREDICTED: group IIE secretory phospholipase A2 [Gorilla gorilla gorilla] |
| GI:7657461 | RefSeq | XP_005544625.1 | 142 | PREDICTED: group IIE secretory phospholipase A2 [Macaca fascicularis] |