Gene/Proteome Database (LMPD)
LMPD ID
LMP002521
Gene ID
Species
Homo sapiens (Human)
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Gene Symbol
Synonyms
-
Alternate Names
3-oxo-5-alpha-steroid 4-dehydrogenase 2; S5AR 2; SR type 2; 5 alpha-SR2; type II 5-alpha reductase; steroid 5-alpha-reductase 2
Chromosome
2
Map Location
2p23
EC Number
1.3.1.22
Summary
This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| 3-oxo-5-alpha-steroid 4-dehydrogenase 2 | |
|---|---|
| Refseq ID | NP_000339 |
| Protein GI | 39812447 |
| UniProt ID | P31213 |
| mRNA ID | NM_000348 |
| Length | 254 |
| RefSeq Status | REVIEWED |
| MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF | |
Gene Information
Entrez Gene ID
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003865 | IEA:InterPro | F | 3-oxo-5-alpha-steroid 4-dehydrogenase activity |
| GO:0047751 | IEA:UniProtKB-EC | F | cholestenone 5-alpha-reductase activity |
| GO:0009917 | IDA:UniProtKB | F | sterol 5-alpha reductase activity |
| GO:0006702 | TAS:Reactome | P | androgen biosynthetic process |
| GO:0008209 | IDA:UniProtKB | P | androgen metabolic process |
| GO:0030154 | IEA:UniProtKB-KW | P | cell differentiation |
| GO:0007267 | TAS:UniProtKB | P | cell-cell signaling |
| GO:0008584 | IMP:UniProtKB | P | male gonad development |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0008202 | TAS:Reactome | P | steroid metabolic process |
KEGG Pathway Links
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY66-378 | androgen biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_11059 | Androgen biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Protein Entry
S5A2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | pH dependence: Optimally active at acidic pHs.; |
| Catalytic Activity | A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo- Delta(4)-steroid + NADPH. |
| Disease | Pseudovaginal perineoscrotal hypospadias (PPSH) [MIM |
| Function | Converts testosterone (T) into 5-alpha- dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology. |
| Polymorphism | Individuals with Thr-49 have an increased risk of prostate cancer. The enzyme with Thr-49 has a higher in vitro V(max) than the Ala-49 enzyme. |
| Similarity | Belongs to the steroid 5-alpha reductase family. |
| Subcellular Location | Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Expressed in high levels in the prostate and many other androgen-sensitive tissues. |
| Web Resource | Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/srd5a2/"; |
| Web Resource | Name=Wikipedia; Note=5-alpha reductase entry; URL="http://en.wikipedia.org/wiki/5_alpha_reductase"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP002521 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 39812447 | RefSeq | NP_000339 | 254 | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
Identical Sequences to LMP002521 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:39812447 | GenBank | ABQ59050.1 | 254 | SRD5A2 protein [Homo sapiens] |
| GI:39812447 | GenBank | ACE87820.1 | 254 | steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) protein [synthetic construct] |
| GI:39812447 | GenBank | ACT64378.1 | 254 | steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) protein, partial [synthetic construct] |
| GI:39812447 | GenBank | ADR82875.1 | 254 | steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2), partial [synthetic construct] |
| GI:39812447 | GenBank | AHE01385.1 | 254 | Sequence 56301 from patent US 8586006 |
| GI:39812447 | GenBank | AIC49782.1 | 254 | SRD5A2, partial [synthetic construct] |
Related Sequences to LMP002521 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:39812447 | DBBJ | BAG38184.1 | 254 | unnamed protein product [Homo sapiens] |
| GI:39812447 | GenBank | AAA60586.1 | 254 | steroid 5-alpha-reductase 2 [Homo sapiens] |
| GI:39812447 | GenBank | AAA71249.1 | 254 | Sequence 6 from patent US 5422262 |
| GI:39812447 | GenBank | AAW56942.1 | 254 | steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) [Homo sapiens] |
| GI:39812447 | pat | US | 254 | Sequence 6 from patent US 5679521 |
| GI:39812447 | SwissProt | P31213.1 | 254 | RecName: Full=3-oxo-5-alpha-steroid 4-dehydrogenase 2; AltName: Full=5 alpha-SR2; AltName: Full=SR type 2; AltName: Full=Steroid 5-alpha-reductase 2; Short=S5AR 2; AltName: Full=Type II 5-alpha reductase [Homo sapiens] |