Gene/Proteome Database (LMPD)

LMPD ID
LMP002506
Gene ID
57048
Species
Homo sapiens (Human)
Gene Name
phospholipid scramblase 3
Gene Symbol
PLSCR3
Synonyms
-
Alternate Names
phospholipid scramblase 3; PL scramblase 3; ca(2+)-dependent phospholipid scramblase 3
Chromosome
17
Map Location
17p13.1

Proteins

phospholipid scramblase 3
Refseq ID NP_065093
Protein GI 31543417
UniProt ID Q9NRY6
mRNA ID NM_020360
Length 295
RefSeq Status VALIDATED
MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAVTS
phospholipid scramblase 3
Refseq ID NP_001188505
Protein GI 320118922
UniProt ID Q9NRY6
mRNA ID NM_001201576
Length 295
RefSeq Status VALIDATED
Protein sequence is identical to GI:31543417 (mRNA isoform)

Gene Information

Entrez Gene ID
57048
Gene Name
phospholipid scramblase 3
Gene Symbol
PLSCR3
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0005886 IDA:UniProtKB C plasma membrane
GO:0005509 NAS:UniProtKB F calcium ion binding
GO:0048306 IPI:UniProtKB F calcium-dependent protein binding
GO:0017128 NAS:UniProtKB F phospholipid scramblase activity
GO:0006915 IEA:UniProtKB-KW P apoptotic process
GO:0071222 IEA:Ensembl P cellular response to lipopolysaccharide
GO:0042632 IEA:Ensembl P cholesterol homeostasis
GO:0042593 IEA:Ensembl P glucose homeostasis
GO:0017121 NAS:UniProtKB P phospholipid scrambling

Domain Information

InterPro Annotations

Accession Description
IPR005552 Scramblase

UniProt Annotations

Entry Information

Gene Name
phospholipid scramblase 3
Protein Entry
PLS3_HUMAN
UniProt ID
Q9NRY6
Species
Human

Comments

Comment Type Description
Cofactor Name=Ca(2+); Xref=ChEBI
Domain The N-terminal proline-rich domain (PRD) is required for phospholipid scramblase activity.
Function May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. Seems to play a role in apoptosis, through translocation of cardiolipin from the inner to the outer mitochondrial membrane which promotes BID recruitment and enhances tBid-induced mitochondrial damages.
Interaction O75340:PDCD6; NbExp=9; IntAct=EBI-750734, EBI-352915;
Ptm Phosphorylation at Thr-21 by PKC/PRKCD upon apoptotic stimuli enhances flip-flop activity.
Similarity Belongs to the phospholipid scramblase family.
Subcellular Location Mitochondrion membrane ; Single-pass type II membrane protein .
Subunit Interacts with PDCD6 in a calcium-dependent manner.
Tissue Specificity Expressed in heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, uterus, small intestine and peripheral blood lymphocytes. Not detected in testis, brain and liver.

Identical and Related Proteins

Unique RefSeq proteins for LMP002506 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
31543417 RefSeq NP_065093 295 phospholipid scramblase 3

Identical Sequences to LMP002506 proteins

Reference Database Accession Length Protein Name
GI:31543417 DBBJ BAC11458.1 295 unnamed protein product [Homo sapiens]
GI:31543417 DBBJ BAG73533.1 295 phospholipid scramblase 3, partial [synthetic construct]
GI:31543417 EMBL CAF86478.1 295 unnamed protein product [Homo sapiens]
GI:31543417 GenBank AAH93026.1 295 Phospholipid scramblase 3 [Homo sapiens]
GI:31543417 RefSeq NP_001188505.1 295 phospholipid scramblase 3 [Homo sapiens]
GI:31543417 SwissProt Q9NRY6.2 295 RecName: Full=Phospholipid scramblase 3; Short=PL scramblase 3; AltName: Full=Ca(2+)-dependent phospholipid scramblase 3 [Homo sapiens]

Related Sequences to LMP002506 proteins

Reference Database Accession Length Protein Name
GI:31543417 DBBJ BAF82806.1 295 unnamed protein product [Homo sapiens]
GI:31543417 EMBL CAD83802.1 295 unnamed protein product [Homo sapiens]
GI:31543417 GenBank AAF91083.1 295 phospholipid scramblase 3 [Homo sapiens]
GI:31543417 GenBank EAW90198.1 350 hCG1987383, isoform CRA_a [Homo sapiens]
GI:31543417 GenBank EAW90200.1 295 hCG1987383, isoform CRA_c [Homo sapiens]
GI:31543417 GenBank EAW90202.1 350 hCG1987383, isoform CRA_a [Homo sapiens]