Gene/Proteome Database (LMPD)

LMPD ID
LMP002474
Gene ID
57105
Species
Homo sapiens (Human)
Gene Name
cysteinyl leukotriene receptor 2
Gene Symbol
CYSLTR2
Synonyms
CYSLT2; CYSLT2R; HG57; HPN321; KPG_011; hGPCR21
Chromosome
13
Map Location
13q14.2
Summary
The cysteinyl leukotrienes LTC4, LTD4, and LTE4 are important mediators of human bronchial asthma. Pharmacologic studies have determined that cysteinyl leukotrienes activate at least 2 receptors, the protein encoded by this gene and CYSLTR1. This encoded receptor is a member of the superfamily of G protein-coupled receptors. It seems to play a major role in endocrine and cardiovascular systems. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for CYSLTR2

Proteins

cysteinyl leukotriene receptor 2
Refseq ID NP_065110
Protein GI 9966851
UniProt ID Q5KU17
mRNA ID NM_020377
Length 346
RefSeq Status REVIEWED
MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSIYVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQNGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV

Gene Information

Entrez Gene ID
57105
Gene Name
cysteinyl leukotriene receptor 2
Gene Symbol
CYSLTR2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:InterPro C integral component of membrane
GO:0001631 IEA:Ensembl F cysteinyl leukotriene receptor activity
GO:0070374 IEA:Ensembl P positive regulation of ERK1 and ERK2 cascade
GO:0045766 IEA:Ensembl P positive regulation of angiogenesis
GO:0010942 IEA:Ensembl P positive regulation of cell death

KEGG Pathway Links

KEGG Pathway ID Description
hsa04020 Calcium signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_21340 GPCR ligand binding
REACT_18302 Leukotriene receptors

Domain Information

InterPro Annotations

Accession Description
IPR004071 Cysteinyl leukotriene receptor
IPR013311 Cysteinyl leukotriene receptor 2
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
cysteinyl leukotriene receptor 2
Protein Entry
CLTR2_HUMAN
UniProt ID
Q5KU17
Species
Human

Identical and Related Proteins

Unique RefSeq proteins for LMP002474 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
9966851 RefSeq NP_065110 346 cysteinyl leukotriene receptor 2

Identical Sequences to LMP002474 proteins

Reference Database Accession Length Protein Name
GI:9966851 DBBJ BAF84428.1 346 unnamed protein product [Homo sapiens]
GI:9966851 DBBJ BAJ20971.1 346 cysteinyl leukotriene receptor 2, partial [synthetic construct]
GI:9966851 GenBank ABW44263.1 346 Sequence 40 from patent US 7258971
GI:9966851 GenBank ACS02917.1 346 Sequence 30 from patent US 7531310
GI:9966851 GenBank ADS95930.1 346 Sequence 14 from patent US 7829298
GI:9966851 GenBank AFK97663.1 346 Sequence 20 from patent US 8158593

Related Sequences to LMP002474 proteins

Reference Database Accession Length Protein Name
GI:9966851 EMBL CAC69290.1 346 unnamed protein product [Homo sapiens]
GI:9966851 GenBank AAQ46965.1 346 Sequence 2 from patent US 6586205
GI:9966851 GenBank AAY77244.1 346 Sequence 88 from patent US 6902902
GI:9966851 GenBank ACS02933.1 341 Sequence 55 from patent US 7531310
GI:9966851 GenBank ADS95945.1 346 Sequence 88 from patent US 7829298
GI:9966851 GenBank AIC56853.1 346 CYSLTR2, partial [synthetic construct]