Gene/Proteome Database (LMPD)
LMPD ID
LMP002420
Gene ID
Species
Homo sapiens (Human)
Gene Name
thromboxane A synthase 1 (platelet)
Gene Symbol
Synonyms
BDPLT14; CYP5; CYP5A1; GHOSAL; THAS; TS; TXAS; TXS
Alternate Names
thromboxane-A synthase; TXA synthase; cytochrome P450 5A1; platelet, cytochrome P450, subfamily V; cytochrome P450, family 5, subfamily A, polypeptide 1
Chromosome
7
Map Location
7q34-q35
EC Number
5.3.99.5
Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Orthologs
Proteins
| thromboxane-A synthase isoform 1 | |
|---|---|
| Refseq ID | NP_001124438 |
| Protein GI | 195972896 |
| UniProt ID | P24557 |
| mRNA ID | NM_001130966 |
| Length | 534 |
| RefSeq Status | REVIEWED |
| MMEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR | |
| thromboxane-A synthase isoform 1 | |
|---|---|
| Refseq ID | NP_001052 |
| Protein GI | 195972898 |
| UniProt ID | P24557 |
| mRNA ID | NM_001061 |
| Length | 534 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:195972896 (mRNA isoform) | |
| thromboxane-A synthase isoform 2 | |
|---|---|
| Refseq ID | NP_112246 |
| Protein GI | 195972900 |
| UniProt ID | P24557 |
| mRNA ID | NM_030984 |
| Length | 460 |
| RefSeq Status | REVIEWED |
| MMEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERYRCS | |
| thromboxane-A synthase isoform 3 | |
|---|---|
| Refseq ID | NP_001159725 |
| Protein GI | 261278370 |
| UniProt ID | P24557 |
| mRNA ID | NM_001166253 |
| Length | 580 |
| RefSeq Status | REVIEWED |
| MMEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGALMSAFSPEKLNELGLLIMQERIKGHMGGQQAPQRIPPTRLSKPSGIYVNLHYATLPFCMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR | |
| thromboxane-A synthase isoform 4 | |
|---|---|
| Refseq ID | NP_001159726 |
| Protein GI | 261278372 |
| UniProt ID | P24557 |
| mRNA ID | NM_001166254 |
| Length | 466 |
| RefSeq Status | REVIEWED |
| MELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR | |
Gene Information
Entrez Gene ID
Gene Name
thromboxane A synthase 1 (platelet)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0020037 | IEA:InterPro | F | heme binding |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0004497 | IEA:UniProtKB-KW | F | monooxygenase activity |
| GO:0016705 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
| GO:0004796 | IEA:UniProtKB-EC | F | thromboxane-A synthase activity |
| GO:0019369 | TAS:Reactome | P | arachidonic acid metabolic process |
| GO:0030644 | IEA:Ensembl | P | cellular chloride ion homeostasis |
| GO:0019371 | TAS:Reactome | P | cyclooxygenase pathway |
| GO:0006690 | TAS:Reactome | P | icosanoid metabolic process |
| GO:0045907 | IEA:Ensembl | P | positive regulation of vasoconstriction |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0006805 | TAS:Reactome | P | xenobiotic metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04611 | Platelet activation |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_150149 | Synthesis of Prostaglandins (PG) and Thromboxanes (TX) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
thromboxane A synthase 1 (platelet)
Protein Entry
THAS_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=P24557-1; Sequence=Displayed; Name=2; IsoId=P24557-2; Sequence=VSP_047217; Note=No experimental confirmation available.; Name=3; IsoId=P24557-3; Sequence=VSP_054121; Name=4; IsoId=P24557-4; Sequence=VSP_054122, VSP_054123; |
| Catalytic Activity | (5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-9-alpha,11-alpha- epoxy-15-hydroxythromboxa-5,13-dienoate. |
| Caution | It is uncertain whether Met-1 is the initiator. An alternative upstream Met is found in primates, but not in other mammals. |
| Cofactor | Name=heme; Xref=ChEBI |
| Disease | Ghosal hematodiaphyseal dysplasia (GHDD) [MIM |
| Disease | Note=Thromboxane synthetase deficiency has been detected in some patients with a bleeding disorder due to platelet dysfunction. |
| Sequence Caution | Sequence=AAA60617.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAA60618.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAC01761.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=AAC01761.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99269.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99270.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99271.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99272.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99273.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99274.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99275.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99276.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99277.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99278.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99279.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAH41157.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=BAG58828.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=EAW83934.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; |
| Similarity | Belongs to the cytochrome P450 family. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
| Subunit | Monomer. |
| Tissue Specificity | Platelets, lung, kidney, spleen, macrophages and lung fibroblasts. |
| Web Resource | Name=Cytochrome P450 Allele Nomenclature Committee; Note=CYP5A1 alleles; URL="http://www.cypalleles.ki.se/cyp5a1.htm"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP002420 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 195972896 | RefSeq | NP_001124438 | 534 | thromboxane-A synthase isoform 1 |
| 195972900 | RefSeq | NP_112246 | 460 | thromboxane-A synthase isoform 2 |
| 261278370 | RefSeq | NP_001159725 | 580 | thromboxane-A synthase isoform 3 |
| 261278372 | RefSeq | NP_001159726 | 466 | thromboxane-A synthase isoform 4 |
Identical Sequences to LMP002420 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:261278370 | DBBJ | BAG58828.1 | 580 | unnamed protein product [Homo sapiens] |
| GI:195972896 | DBBJ | BAJ20885.1 | 534 | thromboxane A synthase 1, partial [synthetic construct] |
| GI:261278372 | GenBank | AAH14117.1 | 466 | TBXAS1 protein [Homo sapiens] |
| GI:261278372 | GenBank | EAW83934.1 | 466 | hCG2044058 [Homo sapiens] |
| GI:195972896 | GenBank | EAW83935.1 | 534 | hCG14925, isoform CRA_a [Homo sapiens] |
| GI:195972900 | GenBank | EAW83936.1 | 460 | hCG14925, isoform CRA_b [Homo sapiens] |
| GI:195972896 | GenBank | ABY14916.1 | 534 | Sequence 291 from patent US 7306913 |
| GI:195972896 | GenBank | ABY14917.1 | 534 | Sequence 292 from patent US 7306913 |
| GI:195972900 | GenBank | ABY14918.1 | 460 | Sequence 293 from patent US 7306913 |
| GI:261278372 | GenBank | ADQ31780.1 | 466 | thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A), partial [synthetic construct] |
| GI:195972896 | GenBank | AED45728.1 | 534 | Sequence 2004 from patent US 7892730 |
| GI:261278372 | GenBank | AIC49841.1 | 466 | TBXAS1, partial [synthetic construct] |
| GI:195972896 | RefSeq | NP_001052.2 | 534 | thromboxane-A synthase isoform 1 [Homo sapiens] |
Related Sequences to LMP002420 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:195972900 | GenBank | AAA60617.1 | 460 | thromboxane synthase [Homo sapiens] |
| GI:195972896 | GenBank | AAF99269.1 | 534 | thromboxane synthase [Homo sapiens] |
| GI:195972896 | GenBank | AAF99270.1 | 534 | thromboxane synthase [Homo sapiens] |
| GI:195972896 | GenBank | AAF99271.1 | 534 | thromboxane synthase [Homo sapiens] |
| GI:261278372 | GenBank | AAH41157.1 | 534 | Thromboxane A synthase 1 (platelet) [Homo sapiens] |
| GI:195972900 | GenBank | AAH41157.1 | 534 | Thromboxane A synthase 1 (platelet) [Homo sapiens] |
| GI:261278372 | GenBank | EAW83935.1 | 534 | hCG14925, isoform CRA_a [Homo sapiens] |
| GI:195972900 | GenBank | EAW83935.1 | 534 | hCG14925, isoform CRA_a [Homo sapiens] |
| GI:261278372 | GenBank | ABY14916.1 | 534 | Sequence 291 from patent US 7306913 |
| GI:261278372 | GenBank | ABY14917.1 | 534 | Sequence 292 from patent US 7306913 |
| GI:195972896 | GenBank | ACM85663.1 | 554 | Sequence 11161 from patent US 6812339 |
| GI:195972896 | GenBank | ACM85664.1 | 554 | Sequence 11162 from patent US 6812339 |
| GI:261278372 | GenBank | AED45728.1 | 534 | Sequence 2004 from patent US 7892730 |
| GI:195972900 | GenBank | AED45728.1 | 534 | Sequence 2004 from patent US 7892730 |
| GI:261278370 | GenBank | EHH17731.1 | 580 | hypothetical protein EGK_14193 [Macaca mulatta] |
| GI:195972900 | GenBank | AFD45262.1 | 460 | Sequence 255 from patent US 8129114 |
| GI:195972896 | GenBank | AHD76432.1 | 534 | Sequence 19705 from patent US 8586006 |
| GI:195972900 | GenBank | AHD76433.1 | 460 | Sequence 19706 from patent US 8586006 |
| GI:261278372 | RefSeq | NP_001124438.1 | 534 | thromboxane-A synthase isoform 1 [Homo sapiens] |
| GI:261278370 | RefSeq | XP_002803529.1 | 580 | PREDICTED: thromboxane-A synthase [Macaca mulatta] |
| GI:261278370 | RefSeq | XP_003270853.1 | 580 | PREDICTED: thromboxane-A synthase isoform 2 [Nomascus leucogenys] |
| GI:261278370 | RefSeq | XP_003318881.1 | 580 | PREDICTED: thromboxane-A synthase isoform X5 [Pan troglodytes] |
| GI:261278370 | RefSeq | XP_005550979.1 | 580 | PREDICTED: thromboxane-A synthase isoform X1 [Macaca fascicularis] |
| GI:261278370 | RefSeq | XP_007981327.1 | 580 | PREDICTED: thromboxane-A synthase isoform X8 [Chlorocebus sabaeus] |