Gene/Proteome Database (LMPD)

LMPD ID
LMP002216
Gene ID
75750
Species
Mus musculus (Mouse)
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter family), member 6
Gene Symbol
Slc10a6
Synonyms
8430417G17Rik; C78479; Soat
Alternate Names
solute carrier family 10 member 6; sodium-dependent organic anion transporter
Chromosome
5
Map Location
5 E5|5

Proteins

solute carrier family 10 member 6
Refseq ID NP_083691
Protein GI 21313062
UniProt ID Q9CXB2
mRNA ID NM_029415
Length 373
RefSeq Status PROVISIONAL
MSTDCAGNSTCPVNSTEEDPPVGMEGHANLKLLFTVLSAVMVGLVMFSFGCSVESQKLWLHLRRPWGIAVGLLSQFGLMPLTAYLLAIGFGLKPFQAIAVLMMGSCPGGTISNVLTFWVDGDMDLSISMTTCSTVAALGMMPLCLYIYTRSWTLTQNLVIPYQSIGITLVSLVVPVASGVYVNYRWPKQATVILKVGAILGGMLLLVVAVTGMVLAKGWNTDVTLLVISCIFPLVGHVTGFLLAFLTHQSWQRCRTISIETGAQNIQLCIAMLQLSFSAEYLVQLLNFALAYGLFQVLHGLLIVAAYQAYKRRQKSKCRRQHPDCPDVCYEKQPRETSAFLDKGDEAAVTLGPVQPEQHHRAAELTSHIPSCE

Gene Information

Entrez Gene ID
75750
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter family), member 6
Gene Symbol
Slc10a6
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008508 IEA:InterPro F bile acid:sodium symporter activity
GO:0043250 IEA:Ensembl F sodium-dependent organic anion transmembrane transporter activity
GO:0043251 IEA:Ensembl P sodium-dependent organic anion transport

REACTOME Pathway Links

REACTOME Pathway ID Description
5892774 SLC-mediated transmembrane transport
5892775 Transmembrane transport of small molecules
5893405 Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds

Domain Information

InterPro Annotations

Accession Description
IPR002657 Bile acid:sodium symporter/arsenical resistance protein Acr3

UniProt Annotations

Entry Information

Gene Name
solute carrier family 10 (sodium/bile acid cotransporter family), member 6
Protein Entry
SOAT_MOUSE
UniProt ID
Q9CXB2
Species
Mouse

Comments

Comment Type Description
Function Transports sulfoconjugated steroid hormones, as well as taurolithocholic acid-3-sulfate and sulfoconjugated pyrenes in a sodium-dependent manner. {ECO:0000250}.
Ptm Glycosylated. {ECO:0000250}.
Similarity Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP002216 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21313062 RefSeq NP_083691 373 solute carrier family 10 member 6

Identical Sequences to LMP002216 proteins

Reference Database Accession Length Protein Name
GI:21313062 EMBL CAE47479.1 373 sodium-dependent organic anion transporter [Mus musculus]
GI:21313062 GenBank AAI27609.1 373 Solute carrier family 10 (sodium/bile acid cotransporter family), member 6 [Mus musculus]
GI:21313062 GenBank AAI39344.1 373 Solute carrier family 10 (sodium/bile acid cotransporter family), member 6 [Mus musculus]
GI:21313062 GenBank AAI39347.1 373 Solute carrier family 10 (sodium/bile acid cotransporter family), member 6 [Mus musculus]
GI:21313062 GenBank ADS13342.1 373 Sequence 104 from patent US 7754856
GI:21313062 SwissProt Q9CXB2.1 373 RecName: Full=Solute carrier family 10 member 6; AltName: Full=Sodium-dependent organic anion transporter [Mus musculus]

Related Sequences to LMP002216 proteins

Reference Database Accession Length Protein Name
GI:21313062 EMBL CAE47478.1 370 sodium-dependent organic anion transporter [Rattus norvegicus]
GI:21313062 GenBank ERE88765.1 562 solute carrier family 10 member 6-like protein [Cricetulus griseus]
GI:21313062 RefSeq NP_932166.1 370 solute carrier family 10 member 6 [Rattus norvegicus]
GI:21313062 RefSeq XP_005076481.1 394 PREDICTED: LOW QUALITY PROTEIN: solute carrier family 10 member 6 [Mesocricetus auratus]
GI:21313062 RefSeq XP_006975481.1 364 PREDICTED: solute carrier family 10 member 6 [Peromyscus maniculatus bairdii]
GI:21313062 SwissProt Q70EX6.1 370 RecName: Full=Solute carrier family 10 member 6; AltName: Full=Sodium-dependent organic anion transporter [Rattus norvegicus]