LIPID MAPS

LMPD ID

LMP002195

Gene ID

9265

Species

Homo sapiens (Human)

Gene Name

cytohesin 3

Gene Symbol

CYTH3

Synonyms

ARNO3; GRP1; PSCD3

Alternate Names

cytohesin-3; ARF nucleotide-binding site opener 3; general receptor of phosphoinositides 1; pleckstrin homology, Sec7 and coiled-coil domains 3; PH, SEC7 and coiled-coil domain-containing protein 3

Chromosome

7

Map Location

7p22.1

Summary

This gene encodes a member of the PSCD (pleckstrin homology, Sec7 and coiled-coil domains) family. PSCD family members have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This encoded protein is involved in the control of Golgi structure and function, and it may have a physiological role in regulating ADP-ribosylation factor protein 6 (ARF) functions, in addition to acting on ARF1. [provided by RefSeq, Jul 2008]

Orthologs

View orthologs and multiple alignments for CYTH3

cytohesin-3
Refseq ID	NP_004218
Protein GI	4758968
UniProt ID	O43739
mRNA ID	NM_004227
Length	399
RefSeq Status	REVIEWED
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK

Entrez Gene ID

9265

Gene Name

cytohesin 3

Gene Symbol

CYTH3

Species

Homo sapiens

Gene Ontology (GO Annotations)

GO ID	Source	Type	Description
GO:0005829	IDA:UniProtKB	C	cytosol
GO:0031234	IDA:UniProtKB	C	extrinsic component of cytoplasmic side of plasma membrane
GO:0005886	IDA:UniProtKB	C	plasma membrane
GO:0001726	IEA:Ensembl	C	ruffle
GO:0005086	IDA:UniProtKB	F	ARF guanyl-nucleotide exchange factor activity
GO:0005547	IDA:UniProtKB	F	phosphatidylinositol-3,4,5-trisphosphate binding
GO:0048193	IMP:UniProtKB	P	Golgi vesicle transport
GO:0090162	IEA:Ensembl	P	establishment of epithelial cell polarity
GO:0043547	IDA:GOC	P	positive regulation of GTPase activity
GO:0045785	IEA:Ensembl	P	positive regulation of cell adhesion
GO:0032012	IEA:InterPro	P	regulation of ARF protein signal transduction
GO:0030155	IBA:RefGenome	P	regulation of cell adhesion

KEGG Pathway Links

KEGG Pathway ID	Description
hsa04144	Endocytosis

InterPro Annotations

Accession	Description
IPR001849	Pleckstrin homology domain
IPR011993	Pleckstrin homology-like domain
IPR000904	Sec7 domain
IPR023394	Sec7 domain, alpha orthogonal bundle

Entry Information

Gene Name

cytohesin 3

Protein Entry

CYH3_HUMAN

UniProt ID

O43739

Species

Human

Comments

Comment Type	Description
Alternative Products	Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O43739-1; Sequence=Displayed; Name=2; IsoId=O43739-2; Sequence=VSP_006039;
Domain	Autoinhibited by its C-terminal basic region.
Domain	Binds via its PH domain to the inositol head group of phosphatidylinositol 3,4,5-trisphosphate.
Function	Promotes guanine-nucleotide exchange on ARF1 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. {ECO
Similarity	Contains 1 PH domain. {ECO
Similarity	Contains 1 SEC7 domain. {ECO
Subcellular Location	Cytoplasm, cytosol. Cell membrane; Peripheral membrane protein. Note=Translocates from the cytosol to membranes enriched in phosphatidylinositol 3,4,5-trisphosphate.
Subunit	Interacts with GRASP (By similarity). Interacts with ARF6.
Tissue Specificity	Almost absent from liver, thymus and peripheral blood lymphocytes.

Unique RefSeq proteins for LMP002195 (as displayed in Record Overview)

Protein GI	Database	Accession	Length	Protein Name
4758968	RefSeq	NP_004218	399	cytohesin-3

Identical Sequences to LMP002195 proteins

Reference	Database	Accession	Length	Protein Name
GI:4758968	GenBank	JAA07066.1	399	cytohesin 3 [Pan troglodytes]
GI:4758968	GenBank	JAA17214.1	399	cytohesin 3 [Pan troglodytes]
GI:4758968	GenBank	JAA43137.1	399	cytohesin 3 [Pan troglodytes]
GI:4758968	RefSeq	XP_005549139.1	399	PREDICTED: cytohesin-3 isoform X1 [Macaca fascicularis]
GI:4758968	RefSeq	XP_009200836.1	399	PREDICTED: cytohesin-3 isoform X1 [Papio anubis]
GI:4758968	RefSeq	XP_009200837.1	399	PREDICTED: cytohesin-3 isoform X1 [Papio anubis]

Related Sequences to LMP002195 proteins

Reference	Database	Accession	Length	Protein Name
GI:4758968	GenBank	ACM82827.1	404	Sequence 8325 from patent US 6812339
GI:4758968	RefSeq	XP_005549140.1	400	PREDICTED: cytohesin-3 isoform X2 [Macaca fascicularis]
GI:4758968	RefSeq	XP_008016916.1	514	PREDICTED: cytohesin-3 isoform X1 [Chlorocebus sabaeus]
GI:4758968	RefSeq	XP_008822228.1	399	PREDICTED: cytohesin-3 isoform X1 [Nannospalax galili]
GI:4758968	RefSeq	XP_009240803.1	400	PREDICTED: cytohesin-3 [Pongo abelii]
GI:4758968	SwissProt	O43739.2	400	RecName: Full=Cytohesin-3; AltName: Full=ARF nucleotide-binding site opener 3; Short=Protein ARNO3; AltName: Full=General receptor of phosphoinositides 1; Short=Grp1; AltName: Full=PH, SEC7 and coiled-coil domain-containing protein 3 [Homo sapiens]