Gene/Proteome Database (LMPD)
LMPD ID
LMP002121
Gene ID
Species
Mus musculus (Mouse)
Gene Name
CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase)
Gene Symbol
Synonyms
9530042F15Rik; D7Bwg0575e; Pis; Pis1
Alternate Names
CDP-diacylglycerol--inositol 3-phosphatidyltransferase; PI synthase; ptdIns synthase; phosphatidylinositol synthase
Chromosome
7
Map Location
7 F4|7 69.26 cM
EC Number
2.7.8.11
Proteins
| CDP-diacylglycerol--inositol 3-phosphatidyltransferase | |
|---|---|
| Refseq ID | NP_080914 |
| Protein GI | 28076897 |
| UniProt ID | Q8VDP6 |
| mRNA ID | NM_026638 |
| Length | 213 |
| RefSeq Status | VALIDATED |
| MPEENIFLFVPNLIGYARIVFAIISFYFMPCCPFTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCATMCLLVNLALLYPRATLLFQLSMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFNFSEGPLVGSVGLFRMGLWVTAPIALLKSVISVIHLITAARNMAALDAADRAKKK | |
Gene Information
Entrez Gene ID
Gene Name
CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | ISS:UniProtKB | C | integral component of membrane |
| GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
| GO:0003881 | ISS:UniProtKB | F | CDP-diacylglycerol-inositol 3-phosphatidyltransferase activity |
| GO:0043178 | IEA:Ensembl | F | alcohol binding |
| GO:0030246 | IEA:Ensembl | F | carbohydrate binding |
| GO:0019992 | IEA:Ensembl | F | diacylglycerol binding |
| GO:0030145 | IEA:Ensembl | F | manganese ion binding |
| GO:0046341 | IEA:Ensembl | P | CDP-diacylglycerol metabolic process |
| GO:0006661 | ISS:UniProtKB | P | phosphatidylinositol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu00564 | Glycerophospholipid metabolism |
| mmu00562 | Inositol phosphate metabolism |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-6351 | D-myo-inositol (1,4,5)-trisphosphate biosynthesis |
| PWY3DJ-219 | PIP metabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase)
Protein Entry
CDIPT_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | CDP-diacylglycerol + myo-inositol = CMP + phosphatidyl-1D-myo-inositol. |
| Cofactor | Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250}; Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; Note=Divalent metal cations; Mn(2+) or Mg(2+), but Mg(2+) may be much less effective. {ECO:0000250}; |
| Function | Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction. May thus act to reduce an excessive cellular PtdIns content. The exchange activity is due to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the CDP-alcohol phosphatidyltransferase class-I family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Golgi apparatus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Cell membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Membrane {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002121 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 28076897 | RefSeq | NP_080914 | 213 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase |
Identical Sequences to LMP002121 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:28076897 | DBBJ | BAC36542.1 | 213 | unnamed protein product [Mus musculus] |
| GI:28076897 | DBBJ | BAC37580.1 | 213 | unnamed protein product [Mus musculus] |
| GI:28076897 | DBBJ | BAC40756.1 | 213 | unnamed protein product [Mus musculus] |
| GI:28076897 | GenBank | AAH21473.1 | 213 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) [Mus musculus] |
| GI:28076897 | GenBank | AAH24413.1 | 213 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) [Mus musculus] |
| GI:28076897 | SwissProt | Q8VDP6.1 | 213 | RecName: Full=CDP-diacylglycerol--inositol 3-phosphatidyltransferase; AltName: Full=Phosphatidylinositol synthase; Short=PI synthase; Short=PtdIns synthase [Mus musculus] |
Related Sequences to LMP002121 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:28076897 | DBBJ | BAA11634.1 | 213 | phosphatidylinositol synthase [Rattus norvegicus] |
| GI:28076897 | DBBJ | BAA82112.1 | 213 | phosphatidylinositol synthase [Rattus norvegicus] |
| GI:28076897 | GenBank | AAQ80838.1 | 213 | Sequence 3 from patent US 6395468 |
| GI:28076897 | RefSeq | NP_620254.1 | 213 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Rattus norvegicus] |
| GI:28076897 | RefSeq | XP_006230270.1 | 213 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform X1 [Rattus norvegicus] |
| GI:28076897 | SwissProt | P70500.1 | 213 | RecName: Full=CDP-diacylglycerol--inositol 3-phosphatidyltransferase; AltName: Full=Phosphatidylinositol synthase; Short=PI synthase; Short=PtdIns synthase [Rattus norvegicus] |