Gene/Proteome Database (LMPD)

LMPD ID
LMP001998
Gene ID
20388
Species
Mus musculus (Mouse)
Gene Name
surfactant associated protein B
Gene Symbol
Sftpb
Synonyms
AI562151; SF-B; SP-B; Sftp-3; Sftp3
Alternate Names
pulmonary surfactant-associated protein B; pulmonary surfactant-associated proteolipid SPL(Phe)
Chromosome
6
Map Location
6 C1|6 32.27 cM

Proteins

pulmonary surfactant-associated protein B isoform 1 precursor
Refseq ID NP_680088
Protein GI 22296601
UniProt ID P50405
mRNA ID NM_147779
Length 377
RefSeq Status VALIDATED
MAKSHLLQWLLLLPTLCCPGAAITSASSLECAQGPQFWCQSLEHAVQCRALGHCLQEVWGHAGANDLCQECEDIVHLLTKMTKEDAFQEAIRKFLEQECDILPLKLLVPRCRQVLDVYLPLVIDYFQSQINPKAICNHVGLCPRGQAKPEQNPGMPDAVPNPLLDKLVLPVLPGALLARPGPHTQDFSEQQLPIPLPFCWLCRTLIKRVQAVIPKGVLAVAVSQVCHVVPLVVGGICQCLAERYTVLLLDALLGRVVPQLVCGLVLRCSTEDAMGPALPAVEPLIEEWPLQDTECHFCKSVINQAWNTSEQAMPQAMHQACLRFWLDRQKCEQFVEQHMPQLLALVPRSQDAHITCQALGVCEAPASPLQCFQTPHL
sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2380 peptide sequence: MAKSHLLQWLLLLPTLCCPGAA sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2380 peptide sequence: MAKSHLLQWLLLLPTLCCPGAA mat_peptide: 192..270 product: Pulmonary surfactant-associated protein B experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P50405.1) calculated_mol_wt: 8506 peptide sequence: LPIPLPFCWLCRTLIKRVQAVIPKGVLAVAVSQVCHVVPLVVGGICQCLAERYTVLLLDALLGRVVPQLVCGLVLRCST
pulmonary surfactant-associated protein B isoform 2 precursor
Refseq ID NP_001269000
Protein GI 530678024
UniProt ID S4R2L6
mRNA ID NM_001282071
Length 354
RefSeq Status VALIDATED
MAKSHLLQWLLLLPTLCCPGAAITSASSLECAQGPQFWCQSLEHAVQCRALGHCLQEVWGHAGANDLCQECEDIVHLLTKMTKEDAFQEAIRKFLEQECDILPLKLLVPRCRQVLDVYLPLVIDYFQSQINPKAICNHVGLCPRGQAKPEQNPGMPDAVPNPLLDKLVLPVLPGALLARPGPHTQDFSEQQLPIPLPFCWLCRTLIKRVQAVIPKCLAERYTVLLLDALLGRVVPQLVCGLVLRCSTEDAMGPALPAVEPLIEEWPLQDTECHFCKSVINQAWNTSEQAMPQAMHQACLRFWLDRQKCEQFVEQHMPQLLALVPRSQDAHITCQALGVCEAPASPLQCFQTPHL

Gene Information

Entrez Gene ID
20388
Gene Name
surfactant associated protein B
Gene Symbol
Sftpb
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:MGI C cytoplasm
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0005764 IEA:InterPro C lysosome
GO:0007585 IEA:UniProtKB-KW P respiratory gaseous exchange
GO:0006665 IEA:InterPro P sphingolipid metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR008373 Saposin
IPR008139 Saposin B
IPR003119 Saposin type A
IPR011001 Saposin-like
IPR007856 Saposin-like type B, 1
IPR008138 Saposin-like type B, 2

UniProt Annotations

Entry Information

Gene Name
surfactant associated protein B
Protein Entry
S4R2L6_MOUSE
UniProt ID
S4R2L6
Species
Mouse

Comments

Comment Type Description
Function Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air- liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Miscellaneous Pulmonary surfactant consists of 90% lipid and 10% protein. There are 4 surfactant-associated proteins: 2 collagenous, carbohydrate-binding glycoproteins (SP-A and SP-D) and 2 small hydrophobic proteins (SP-B and SP-C).
Similarity Contains 1 saposin A-type domain. {ECO:0000255|PROSITE-ProRule:PRU00414}.
Similarity Contains 3 saposin B-type domains. {ECO:0000255|PROSITE-ProRule:PRU00415}.
Subcellular Location Secreted, extracellular space, surface film.
Subunit Homodimer; disulfide-linked.

Identical and Related Proteins

Unique RefSeq proteins for LMP001998 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22296601 RefSeq NP_680088 377 pulmonary surfactant-associated protein B isoform 1 precursor
530678024 RefSeq NP_001269000 354 pulmonary surfactant-associated protein B isoform 2 precursor

Identical Sequences to LMP001998 proteins

Reference Database Accession Length Protein Name
GI:22296601 GenBank AAB34846.2 377 surfactant protein B [Mus musculus]
GI:22296601 SwissProt P50405.1 377 RecName: Full=Pulmonary surfactant-associated protein B; Short=SP-B; AltName: Full=Pulmonary surfactant-associated proteolipid SPL(Phe); Flags: Precursor [Mus musculus]

Related Sequences to LMP001998 proteins

Reference Database Accession Length Protein Name
GI:22296601 EMBL CAA32885.1 376 pulmonary surfactant-associated protein SP-B, precursor [Rattus norvegicus]
GI:530678024 GenBank AAB34846.2 377 surfactant protein B [Mus musculus]
GI:530678024 GenBank EDK98964.1 376 surfactant associated protein B [Mus musculus]
GI:22296601 GenBank EDK98964.1 376 surfactant associated protein B [Mus musculus]
GI:22296601 PRF - 377 surfactant protein B [Mus musculus]
GI:530678024 PRF - 377 surfactant protein B [Mus musculus]
GI:22296601 RefSeq NP_620197.1 376 pulmonary surfactant-associated protein B precursor [Rattus norvegicus]
GI:530678024 RefSeq NP_680088.1 377 pulmonary surfactant-associated protein B isoform 1 precursor [Mus musculus]
GI:22296601 RefSeq NP_001269000.1 354 pulmonary surfactant-associated protein B isoform 2 precursor [Mus musculus]
GI:530678024 RefSeq XP_006236719.1 353 PREDICTED: pulmonary surfactant-associated protein B isoform X1 [Rattus norvegicus]
GI:22296601 SwissProt P22355.1 376 RecName: Full=Pulmonary surfactant-associated protein B; Short=SP-B; AltName: Full=Pulmonary surfactant-associated proteolipid SPL(Phe); Flags: Precursor [Rattus norvegicus]
GI:530678024 SwissProt P50405.1 377 RecName: Full=Pulmonary surfactant-associated protein B; Short=SP-B; AltName: Full=Pulmonary surfactant-associated proteolipid SPL(Phe); Flags: Precursor [Mus musculus]