Gene/Proteome Database (LMPD)
LMPD ID
LMP001910
Gene ID
Species
Homo sapiens (Human)
Gene Name
RNA binding motif protein 14
Gene Symbol
Synonyms
COAA; PSP2; SIP; SYTIP1; TMEM137
Alternate Names
RNA-binding protein 14; paraspeckle protein 2; SYT-interacting protein; transmembrane protein 137; synaptotagmin-interacting protein; RRM-containing coactivator activator/modulator
Chromosome
11
Map Location
11q13.2
Summary
This gene encodes a ribonucleoprotein that functions as a general nuclear coactivator, and an RNA splicing modulator. This protein contains two RNA recognition motifs (RRM) at the N-terminus, and multiple hexapeptide repeat domain at the C-terminus that interacts with thyroid hormone receptor-binding protein (TRBP), and is required for transcription activation. Alternatively spliced transcript variants encoding different isoforms (with opposing effects on transcription) have been described for this gene. [provided by RefSeq, Oct 2011]
Orthologs
Proteins
| RNA-binding protein 14 isoform 1 | |
|---|---|
| Refseq ID | NP_006319 |
| Protein GI | 5454064 |
| UniProt ID | Q96PK6 |
| mRNA ID | NM_006328 |
| Length | 669 |
| RefSeq Status | REVIEWED |
| MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQQAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASMGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM | |
| RNA-binding protein 14 isoform 2 | |
|---|---|
| Refseq ID | NP_001185765 |
| Protein GI | 311771525 |
| UniProt ID | Q96PK6 |
| mRNA ID | NM_001198836 |
| Length | 156 |
| RefSeq Status | REVIEWED |
| MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGMVPTGV | |
| RNA-binding protein 14 isoform 3 | |
|---|---|
| Refseq ID | NP_001185766 |
| Protein GI | 311771527 |
| UniProt ID | Q96PK6 |
| mRNA ID | NM_001198837 |
| Length | 119 |
| RefSeq Status | REVIEWED |
| MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKGMVPTGV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016592 | NAS:UniProtKB | C | mediator complex |
| GO:0005634 | IDA:HPA | C | nucleus |
| GO:0030529 | TAS:UniProtKB | C | ribonucleoprotein complex |
| GO:0005667 | IPI:UniProtKB | C | transcription factor complex |
| GO:0003723 | NAS:UniProtKB | F | RNA binding |
| GO:0001104 | NAS:UniProtKB | F | RNA polymerase II transcription cofactor activity |
| GO:0030374 | IPI:UniProtKB | F | ligand-dependent nuclear receptor transcription coactivator activity |
| GO:0000166 | IEA:InterPro | F | nucleotide binding |
| GO:0044822 | IDA:UniProtKB | F | poly(A) RNA binding |
| GO:0030674 | NAS:UniProtKB | F | protein binding, bridging |
| GO:0006310 | NAS:UniProtKB | P | DNA recombination |
| GO:0006281 | NAS:UniProtKB | P | DNA repair |
| GO:0006260 | NAS:UniProtKB | P | DNA replication |
| GO:0042921 | NAS:UniProtKB | P | glucocorticoid receptor signaling pathway |
| GO:0016575 | IPI:UniProtKB | P | histone deacetylation |
| GO:0030520 | NAS:UniProtKB | P | intracellular estrogen receptor signaling pathway |
| GO:0045944 | IDA:UniProtKB | P | positive regulation of transcription from RNA polymerase II promoter |
| GO:0009725 | TAS:UniProtKB | P | response to hormone |
| GO:0006366 | NAS:GOC | P | transcription from RNA polymerase II promoter |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=CoAA; IsoId=Q96PK6-1; Sequence=Displayed; Name=2; Synonyms=CoAM; IsoId=Q96PK6-2; Sequence=VSP_015078, VSP_015079; Name=3; IsoId=Q96PK6-3; Sequence=VSP_044641, VSP_044642; Note=No experimental confirmation available.; Name=4; IsoId=Q96PK6-4; Sequence=VSP_047109, VSP_047110; Name=5; IsoId=Q96PK6-5; Sequence=VSP_047494, VSP_047495; |
| Function | Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1. |
| Similarity | Contains 2 RRM (RNA recognition motif) domains. |
| Subcellular Location | Nucleus. Nucleus, nucleolus. Note=In punctate subnuclear structures often located adjacent to splicing speckles, called paraspeckles. |
| Subunit | Isoform 1 interacts with NCOA6, CITED1 and XRCC5/KU86. Isoform 1 interacts with SS18 isoform 1. Isoform 1 interacts with SS18 isoform 2. {ECO |
| Tissue Specificity | Expressed in all tissues tested, including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood lymphocytes. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001910 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 5454064 | RefSeq | NP_006319 | 669 | RNA-binding protein 14 isoform 1 |
| 311771525 | RefSeq | NP_001185765 | 156 | RNA-binding protein 14 isoform 2 |
| 311771527 | RefSeq | NP_001185766 | 119 | RNA-binding protein 14 isoform 3 |
Identical Sequences to LMP001910 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:5454064 | GenBank | AIC50620.1 | 669 | RBM14, partial [synthetic construct] |
| GI:5454064 | GenBank | KFO28361.1 | 669 | RNA-binding protein 14 [Fukomys damarensis] |
| GI:5454064 | RefSeq | XP_004051645.1 | 669 | PREDICTED: RNA-binding protein 14 isoform 1 [Gorilla gorilla gorilla] |
| GI:5454064 | RefSeq | XP_005577186.1 | 669 | PREDICTED: RNA-binding protein 14 isoform X1 [Macaca fascicularis] |
| GI:311771527 | RefSeq | XP_007461993.1 | 119 | PREDICTED: RNA-binding protein 14 isoform X3 [Lipotes vexillifer] |
| GI:5454064 | RefSeq | XP_007971339.1 | 669 | PREDICTED: RNA-binding protein 14 isoform X1 [Chlorocebus sabaeus] |
| GI:311771525 | RefSeq | XP_008050163.1 | 156 | PREDICTED: RNA-binding protein 14 isoform X2 [Tarsius syrichta] |
| GI:311771527 | RefSeq | XP_008050164.1 | 119 | PREDICTED: RNA-binding protein 14 isoform X3 [Tarsius syrichta] |
| GI:311771525 | RefSeq | XP_008145115.1 | 156 | PREDICTED: RNA-binding protein 14 isoform X2 [Eptesicus fuscus] |
| GI:311771527 | RefSeq | XP_008145116.1 | 119 | PREDICTED: RNA-binding protein 14 isoform X3 [Eptesicus fuscus] |
| GI:311771525 | RefSeq | XP_008271854.1 | 156 | PREDICTED: RNA-binding protein 14 isoform X3 [Oryctolagus cuniculus] |
| GI:311771527 | RefSeq | XP_008271857.1 | 119 | PREDICTED: RNA-binding protein 14 isoform X4 [Oryctolagus cuniculus] |
| GI:311771525 | RefSeq | XP_009244377.1 | 156 | PREDICTED: RNA-binding protein 14 isoform X1 [Pongo abelii] |
| GI:311771527 | RefSeq | XP_009244378.1 | 119 | PREDICTED: RNA-binding protein 14 isoform X2 [Pongo abelii] |
| GI:5454064 | RefSeq | XP_010364706.1 | 669 | PREDICTED: RNA-binding protein 14 isoform X1 [Rhinopithecus roxellana] |
| GI:311771525 | RefSeq | XP_010350292.1 | 156 | PREDICTED: RNA-binding protein 14 isoform X3 [Saimiri boliviensis boliviensis] |
| GI:311771527 | RefSeq | XP_010350294.1 | 119 | PREDICTED: RNA-binding protein 14 isoform X5 [Saimiri boliviensis boliviensis] |
| GI:311771525 | RefSeq | XP_010634154.1 | 156 | PREDICTED: RNA-binding protein 14 isoform X5 [Fukomys damarensis] |
Related Sequences to LMP001910 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:5454064 | GenBank | AAK77961.1 | 669 | coactivator activator [Homo sapiens] |
| GI:5454064 | GenBank | JAA08683.1 | 669 | RNA binding motif protein 14 [Pan troglodytes] |
| GI:5454064 | GenBank | JAA16031.1 | 669 | RNA binding motif protein 14 [Pan troglodytes] |
| GI:5454064 | GenBank | JAA25510.1 | 669 | RNA binding motif protein 14 [Pan troglodytes] |
| GI:5454064 | GenBank | JAA38688.1 | 669 | RNA binding motif protein 14 [Pan troglodytes] |
| GI:311771525 | RefSeq | XP_004852341.1 | 156 | PREDICTED: RNA-binding protein 4B-like isoform X7 [Heterocephalus glaber] |
| GI:311771527 | RefSeq | XP_004852345.1 | 119 | PREDICTED: RNA-binding protein 4B-like isoform X11 [Heterocephalus glaber] |
| GI:311771525 | RefSeq | XP_005064102.1 | 156 | PREDICTED: RNA-binding protein 4B-like isoform X6 [Mesocricetus auratus] |
| GI:311771527 | RefSeq | XP_005064104.1 | 119 | PREDICTED: RNA-binding protein 4B-like isoform X8 [Mesocricetus auratus] |
| GI:311771525 | RefSeq | XP_005227121.1 | 156 | PREDICTED: RNA-binding protein 14 isoform X2 [Bos taurus] |
| GI:311771527 | RefSeq | XP_005227123.1 | 119 | PREDICTED: RNA-binding protein 14 isoform X4 [Bos taurus] |
| GI:311771525 | RefSeq | XP_005351744.1 | 156 | PREDICTED: RNA-binding protein 14 isoform X2 [Microtus ochrogaster] |
| GI:311771527 | RefSeq | XP_005351745.1 | 119 | PREDICTED: RNA-binding protein 14 isoform X3 [Microtus ochrogaster] |
| GI:5454064 | RefSeq | XP_005333426.1 | 669 | PREDICTED: RNA-binding protein 14 isoform X1 [Ictidomys tridecemlineatus] |
| GI:311771525 | RefSeq | XP_005968906.1 | 156 | PREDICTED: RNA-binding protein 14 isoform X2 [Pantholops hodgsonii] |
| GI:311771527 | RefSeq | XP_005968907.1 | 119 | PREDICTED: RNA-binding protein 14 isoform X3 [Pantholops hodgsonii] |
| GI:311771525 | RefSeq | XP_006044410.1 | 156 | PREDICTED: RNA-binding protein 14 isoform X2 [Bubalus bubalis] |
| GI:311771527 | RefSeq | XP_006044411.1 | 119 | PREDICTED: RNA-binding protein 14 isoform X3 [Bubalus bubalis] |