Gene/Proteome Database (LMPD)

LMPD ID
LMP001890
Gene ID
Species
Homo sapiens (Human)
Gene Name
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
Gene Symbol
DBI
Synonyms
ACBD1; ACBP; CCK-RP; EP
Chromosome
2
Map Location
2q12-q21
Summary
This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Orthologs

Proteins

acyl-CoA-binding protein isoform 1
Refseq ID NP_065438
Protein GI 10140853
UniProt ID P07108
mRNA ID NM_020548
Length 104
RefSeq Status REVIEWED
MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
acyl-CoA-binding protein isoform 1
Refseq ID NP_001269564
Protein GI 544063480
UniProt ID P07108
mRNA ID NM_001282635
Length 104
RefSeq Status REVIEWED
Protein sequence is identical to GI:10140853 (mRNA isoform)
acyl-CoA-binding protein isoform 1
Refseq ID NP_001269563
Protein GI 544063482
UniProt ID P07108
mRNA ID NM_001282634
Length 104
RefSeq Status REVIEWED
Protein sequence is identical to GI:10140853 (mRNA isoform)
acyl-CoA-binding protein isoform 1
Refseq ID NP_001171513
Protein GI 295849279
UniProt ID P07108
mRNA ID NM_001178042
Length 104
RefSeq Status REVIEWED
Protein sequence is identical to GI:10140853 (mRNA isoform)
acyl-CoA-binding protein isoform 1
Refseq ID NP_001269562
Protein GI 544063478
UniProt ID P07108
mRNA ID NM_001282633
Length 104
RefSeq Status REVIEWED
Protein sequence is identical to GI:10140853 (mRNA isoform)
acyl-CoA-binding protein isoform 2
Refseq ID NP_001073332
Protein GI 120433593
UniProt ID P07108
mRNA ID NM_001079863
Length 88
RefSeq Status REVIEWED
MPAFAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
acyl-CoA-binding protein isoform 3
Refseq ID NP_001073331
Protein GI 120433590
UniProt ID P07108
mRNA ID NM_001079862
Length 87
RefSeq Status REVIEWED
MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
acyl-CoA-binding protein isoform 4
Refseq ID NP_001171488
Protein GI 295849266
UniProt ID P07108
mRNA ID NM_001178017
Length 148
RefSeq Status REVIEWED
MERWGKGLHGLEERGDSVPIPKHRAGRRGGVGKRGVRGRELGGQGKYGAGCSECGTRRIAARGEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
acyl-CoA-binding protein isoform 5
Refseq ID NP_001171512
Protein GI 295842514
UniProt ID P07108
mRNA ID NM_001178041
Length 129
RefSeq Status REVIEWED
MSQHRAGRRGGVGKRGVRGRELGGQGKYGAGCSECGTRRIAARGEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
acyl-CoA-binding protein isoform 6
Refseq ID NP_001171514
Protein GI 295842534
UniProt ID B8ZWD1
mRNA ID NM_001178043
Length 97
RefSeq Status REVIEWED
MSQVQRVHSQAAKAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
acyl-CoA-binding protein isoform 7
Refseq ID NP_001269565
Protein GI 544063486
UniProt ID B8ZWD8
mRNA ID NM_001282636
Length 63
RefSeq Status REVIEWED
MLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Gene Information

Entrez Gene ID
Gene Name
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
Gene Symbol
DBI
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:UniProt C Golgi apparatus
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0070062 IDA:UniProtKB C extracellular vesicular exosome
GO:0005739 IEA:Ensembl C mitochondrion
GO:0097038 IDA:UniProt C perinuclear endoplasmic reticulum
GO:0030156 TAS:ProtInc F benzodiazepine receptor binding
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0036042 IDA:UniProt F long-chain fatty acyl-CoA binding
GO:0046983 IDA:UniProt F protein dimerization activity
GO:0001942 IEA:Ensembl P hair follicle development
GO:0036151 IDA:UniProt P phosphatidylcholine acyl-chain remodeling
GO:0006810 IEA:UniProtKB-KW P transport
GO:0006641 IEA:Ensembl P triglyceride metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa03320 PPAR signaling pathway
ko03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR000582 Acyl-CoA-binding protein, ACBP
IPR022408 Acyl-CoA-binding protein, ACBP, conserved site
IPR014352 FERM/acyl-CoA-binding protein, 3-helical bundle

UniProt Annotations

Entry Information

Gene Name
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
Protein Entry
ACBP_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative promoter usage, Alternative splicing; Named isoforms=6; Name=1; Synonyms=ACBP-1a, Short; IsoId=P07108-1; Sequence=Displayed; Name=2; Synonyms=ACBP-1b, Long; IsoId=P07108-2; Sequence=VSP_000068; Name=3; Synonyms=ACBP-1c; IsoId=P07108-3; Sequence=VSP_038680; Name=4; Synonyms=ACBP-1a1-g; IsoId=P07108-4; Sequence=VSP_043437; Name=5; Synonyms=ACBP-1g; IsoId=P07108-5; Sequence=VSP_043438; Name=6; Synonyms=ACBP-1e; IsoId=P07108-6; Sequence=VSP_044114; Note=Predominantly expressed in adipose tissue and hippocampus.;
Function Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Similarity Belongs to the ACBP family.
Similarity Contains 1 ACB (acyl-CoA-binding) domain.
Subcellular Location Endoplasmic reticulum. Golgi apparatus. Note=Golgi localization is dependent on ligand binding.
Subunit Monomer.
Tissue Specificity Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart. {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP001890 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
10140853 RefSeq NP_065438 104 acyl-CoA-binding protein isoform 1
120433593 RefSeq NP_001073332 88 acyl-CoA-binding protein isoform 2
120433590 RefSeq NP_001073331 87 acyl-CoA-binding protein isoform 3
295849266 RefSeq NP_001171488 148 acyl-CoA-binding protein isoform 4
295842514 RefSeq NP_001171512 129 acyl-CoA-binding protein isoform 5
295842534 RefSeq NP_001171514 97 acyl-CoA-binding protein isoform 6
544063486 RefSeq NP_001269565 63 acyl-CoA-binding protein isoform 7

Identical Sequences to LMP001890 proteins

Reference Database Accession Length Protein Name
GI:120433593 EMBL CAJ00736.1 88 diazepam binding inhibitor, splice form 1c [Homo sapiens]
GI:295842534 EMBL CAR82404.1 97 diazepam binding inhibitor, splice form 1A(2) [Homo sapiens]
GI:295849266 EMBL CAR82409.1 148 diazepam binding inhibitor, splice form 1G [Homo sapiens]
GI:295842514 EMBL CAR82410.1 129 diazepam binding inhibitor, splice form 1A(1)-G [Homo sapiens]
GI:544063486 EMBL CAR82411.1 63 diazepam binding inhibitor, splice form 1D(1) [Homo sapiens]
GI:120433590 GenBank JAA18998.1 87 diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Pan troglodytes]
GI:120433590 GenBank JAA26532.1 87 diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Pan troglodytes]
GI:120433590 GenBank JAA33909.1 87 diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Pan troglodytes]
GI:10140853 GenBank AIC48621.1 104 DBI, partial [synthetic construct]
GI:120433590 RefSeq XP_004031723.1 87 PREDICTED: acyl-CoA-binding protein isoform 1 [Gorilla gorilla gorilla]
GI:120433590 RefSeq XP_004031724.1 87 PREDICTED: acyl-CoA-binding protein isoform 2 [Gorilla gorilla gorilla]
GI:120433590 RefSeq XP_004031725.1 87 PREDICTED: acyl-CoA-binding protein isoform 3 [Gorilla gorilla gorilla]
GI:10140853 RefSeq XP_004031727.1 104 PREDICTED: acyl-CoA-binding protein isoform 5 [Gorilla gorilla gorilla]
GI:10140853 RefSeq XP_004031728.1 104 PREDICTED: acyl-CoA-binding protein isoform 6 [Gorilla gorilla gorilla]
GI:120433593 RefSeq XP_004031729.1 88 PREDICTED: acyl-CoA-binding protein isoform 7 [Gorilla gorilla gorilla]
GI:295842534 RefSeq XP_004031731.1 97 PREDICTED: acyl-CoA-binding protein isoform 9 [Gorilla gorilla gorilla]
GI:10140853 RefSeq NP_001269562.1 104 acyl-CoA-binding protein isoform 1 [Homo sapiens]
GI:10140853 RefSeq NP_001269564.1 104 acyl-CoA-binding protein isoform 1 [Homo sapiens]
GI:10140853 RefSeq NP_001269563.1 104 acyl-CoA-binding protein isoform 1 [Homo sapiens]

Related Sequences to LMP001890 proteins

Reference Database Accession Length Protein Name
GI:120433593 EMBL CAR82404.1 97 diazepam binding inhibitor, splice form 1A(2) [Homo sapiens]
GI:295842514 EMBL CAR82409.1 148 diazepam binding inhibitor, splice form 1G [Homo sapiens]
GI:295842534 EMBL CAR82412.2 144 diazepam binding inhibitor, splice form 1D(2) [Homo sapiens]
GI:544063486 GenBank AAA35788.1 87 endozepine precursor [Homo sapiens]
GI:10140853 GenBank AAZ82205.1 104 diazepam-binding protein, partial [Pan troglodytes]
GI:10140853 GenBank AAZ82206.1 104 diazepam-binding protein, partial [Pan paniscus]
GI:10140853 GenBank AAZ82208.1 104 diazepam-binding protein, partial [Pongo pygmaeus]
GI:10140853 GenBank AAZ82209.1 104 diazepam-binding protein, partial [Symphalangus syndactylus]
GI:10140853 GenBank ACM86039.1 107 Sequence 11537 from patent US 6812339
GI:120433590 GenBank AIC48621.1 104 DBI, partial [synthetic construct]
GI:544063486 pat US 86 Sequence 4 from patent US 5734038
GI:120433590 pat US 86 Sequence 4 from patent US 5734038
GI:295842534 pat US 86 Sequence 4 from patent US 5734038
GI:120433593 pat US 86 Sequence 4 from patent US 5734038
GI:295842534 PDB 2CB8 87 Chain B, High Resolution Crystal Structure Of Liganded Human L-Acbp
GI:544063486 PDB 2CB8 87 Chain B, High Resolution Crystal Structure Of Liganded Human L-Acbp
GI:544063486 PDB 2FJ9 86 Chain A, High Resolution Crystal Structure Of The Unliganded Human Acbp
GI:120433590 PDB 2FJ9 86 Chain A, High Resolution Crystal Structure Of The Unliganded Human Acbp
GI:295842534 PDB 2FJ9 86 Chain A, High Resolution Crystal Structure Of The Unliganded Human Acbp
GI:544063486 RefSeq NP_001073331.1 87 acyl-CoA-binding protein isoform 3 [Homo sapiens]
GI:295849266 RefSeq NP_001171512.1 129 acyl-CoA-binding protein isoform 5 [Homo sapiens]
GI:120433593 RefSeq NP_001171514.1 97 acyl-CoA-binding protein isoform 6 [Homo sapiens]
GI:295842514 RefSeq NP_001171488.1 148 acyl-CoA-binding protein isoform 4 [Homo sapiens]
GI:295842534 RefSeq XP_002799453.1 97 PREDICTED: acyl-CoA-binding protein-like isoform 2 [Macaca mulatta]
GI:295849266 RefSeq XP_002812460.1 148 PREDICTED: acyl-CoA-binding protein isoform X1 [Pongo abelii]
GI:295842514 RefSeq XP_002812460.1 148 PREDICTED: acyl-CoA-binding protein isoform X1 [Pongo abelii]
GI:120433590 RefSeq XP_004031726.1 104 PREDICTED: acyl-CoA-binding protein isoform 4 [Gorilla gorilla gorilla]
GI:120433590 RefSeq XP_004031727.1 104 PREDICTED: acyl-CoA-binding protein isoform 5 [Gorilla gorilla gorilla]
GI:120433590 RefSeq XP_004031728.1 104 PREDICTED: acyl-CoA-binding protein isoform 6 [Gorilla gorilla gorilla]
GI:295842514 RefSeq XP_004031730.1 129 PREDICTED: acyl-CoA-binding protein isoform 8 [Gorilla gorilla gorilla]
GI:120433593 RefSeq XP_004031731.1 97 PREDICTED: acyl-CoA-binding protein isoform 9 [Gorilla gorilla gorilla]
GI:120433593 RefSeq XP_004091662.1 88 PREDICTED: acyl-CoA-binding protein isoform 7 [Nomascus leucogenys]
GI:295842534 RefSeq XP_004091663.1 97 PREDICTED: acyl-CoA-binding protein isoform 8 [Nomascus leucogenys]
GI:295849266 RefSeq XP_005596078.1 148 PREDICTED: LOW QUALITY PROTEIN: diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Macaca fascicularis]
GI:295849266 RefSeq XP_007962924.1 148 PREDICTED: acyl-CoA-binding protein isoform X3 [Chlorocebus sabaeus]
GI:10140853 RefSeq XP_009235925.1 104 PREDICTED: acyl-CoA-binding protein isoform X2 [Pongo abelii]
GI:120433593 RefSeq XP_009235926.1 88 PREDICTED: acyl-CoA-binding protein isoform X3 [Pongo abelii]
GI:295849266 RefSeq XP_009441456.1 148 PREDICTED: acyl-CoA-binding protein isoform X2 [Pan troglodytes]
GI:295842514 RefSeq XP_009441456.1 148 PREDICTED: acyl-CoA-binding protein isoform X2 [Pan troglodytes]
GI:295849266 RefSeq XP_010360455.1 148 PREDICTED: acyl-CoA-binding protein isoform X2 [Rhinopithecus roxellana]
GI:295842514 RefSeq XP_010360455.1 148 PREDICTED: acyl-CoA-binding protein isoform X2 [Rhinopithecus roxellana]
GI:544063486 SwissProt P07108.2 87 RecName: Full=Acyl-CoA-binding protein; Short=ACBP; AltName: Full=Diazepam-binding inhibitor; Short=DBI; AltName: Full=Endozepine; Short=EP [Homo sapiens]