Gene/Proteome Database (LMPD)
LMPD ID
LMP001890
Gene ID
Species
Homo sapiens (Human)
Gene Name
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
Gene Symbol
Synonyms
ACBD1; ACBP; CCK-RP; EP
Chromosome
2
Map Location
2q12-q21
Summary
This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| acyl-CoA-binding protein isoform 1 | |
|---|---|
| Refseq ID | NP_065438 |
| Protein GI | 10140853 |
| UniProt ID | P07108 |
| mRNA ID | NM_020548 |
| Length | 104 |
| RefSeq Status | REVIEWED |
| MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI | |
| acyl-CoA-binding protein isoform 1 | |
|---|---|
| Refseq ID | NP_001269564 |
| Protein GI | 544063480 |
| UniProt ID | P07108 |
| mRNA ID | NM_001282635 |
| Length | 104 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:10140853 (mRNA isoform) | |
| acyl-CoA-binding protein isoform 1 | |
|---|---|
| Refseq ID | NP_001269563 |
| Protein GI | 544063482 |
| UniProt ID | P07108 |
| mRNA ID | NM_001282634 |
| Length | 104 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:10140853 (mRNA isoform) | |
| acyl-CoA-binding protein isoform 1 | |
|---|---|
| Refseq ID | NP_001171513 |
| Protein GI | 295849279 |
| UniProt ID | P07108 |
| mRNA ID | NM_001178042 |
| Length | 104 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:10140853 (mRNA isoform) | |
| acyl-CoA-binding protein isoform 1 | |
|---|---|
| Refseq ID | NP_001269562 |
| Protein GI | 544063478 |
| UniProt ID | P07108 |
| mRNA ID | NM_001282633 |
| Length | 104 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:10140853 (mRNA isoform) | |
| acyl-CoA-binding protein isoform 2 | |
|---|---|
| Refseq ID | NP_001073332 |
| Protein GI | 120433593 |
| UniProt ID | P07108 |
| mRNA ID | NM_001079863 |
| Length | 88 |
| RefSeq Status | REVIEWED |
| MPAFAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI | |
| acyl-CoA-binding protein isoform 3 | |
|---|---|
| Refseq ID | NP_001073331 |
| Protein GI | 120433590 |
| UniProt ID | P07108 |
| mRNA ID | NM_001079862 |
| Length | 87 |
| RefSeq Status | REVIEWED |
| MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI | |
| acyl-CoA-binding protein isoform 4 | |
|---|---|
| Refseq ID | NP_001171488 |
| Protein GI | 295849266 |
| UniProt ID | P07108 |
| mRNA ID | NM_001178017 |
| Length | 148 |
| RefSeq Status | REVIEWED |
| MERWGKGLHGLEERGDSVPIPKHRAGRRGGVGKRGVRGRELGGQGKYGAGCSECGTRRIAARGEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI | |
| acyl-CoA-binding protein isoform 5 | |
|---|---|
| Refseq ID | NP_001171512 |
| Protein GI | 295842514 |
| UniProt ID | P07108 |
| mRNA ID | NM_001178041 |
| Length | 129 |
| RefSeq Status | REVIEWED |
| MSQHRAGRRGGVGKRGVRGRELGGQGKYGAGCSECGTRRIAARGEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI | |
| acyl-CoA-binding protein isoform 6 | |
|---|---|
| Refseq ID | NP_001171514 |
| Protein GI | 295842534 |
| UniProt ID | B8ZWD1 |
| mRNA ID | NM_001178043 |
| Length | 97 |
| RefSeq Status | REVIEWED |
| MSQVQRVHSQAAKAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI | |
| acyl-CoA-binding protein isoform 7 | |
|---|---|
| Refseq ID | NP_001269565 |
| Protein GI | 544063486 |
| UniProt ID | B8ZWD8 |
| mRNA ID | NM_001282636 |
| Length | 63 |
| RefSeq Status | REVIEWED |
| MLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI | |
Gene Information
Entrez Gene ID
Gene Name
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IDA:UniProt | C | Golgi apparatus |
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
| GO:0005739 | IEA:Ensembl | C | mitochondrion |
| GO:0097038 | IDA:UniProt | C | perinuclear endoplasmic reticulum |
| GO:0030156 | TAS:ProtInc | F | benzodiazepine receptor binding |
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0036042 | IDA:UniProt | F | long-chain fatty acyl-CoA binding |
| GO:0046983 | IDA:UniProt | F | protein dimerization activity |
| GO:0001942 | IEA:Ensembl | P | hair follicle development |
| GO:0036151 | IDA:UniProt | P | phosphatidylcholine acyl-chain remodeling |
| GO:0006810 | IEA:UniProtKB-KW | P | transport |
| GO:0006641 | IEA:Ensembl | P | triglyceride metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
Protein Entry
ACBP_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative promoter usage, Alternative splicing; Named isoforms=6; Name=1; Synonyms=ACBP-1a, Short; IsoId=P07108-1; Sequence=Displayed; Name=2; Synonyms=ACBP-1b, Long; IsoId=P07108-2; Sequence=VSP_000068; Name=3; Synonyms=ACBP-1c; IsoId=P07108-3; Sequence=VSP_038680; Name=4; Synonyms=ACBP-1a1-g; IsoId=P07108-4; Sequence=VSP_043437; Name=5; Synonyms=ACBP-1g; IsoId=P07108-5; Sequence=VSP_043438; Name=6; Synonyms=ACBP-1e; IsoId=P07108-6; Sequence=VSP_044114; Note=Predominantly expressed in adipose tissue and hippocampus.; |
| Function | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor. |
| Similarity | Belongs to the ACBP family. |
| Similarity | Contains 1 ACB (acyl-CoA-binding) domain. |
| Subcellular Location | Endoplasmic reticulum. Golgi apparatus. Note=Golgi localization is dependent on ligand binding. |
| Subunit | Monomer. |
| Tissue Specificity | Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP001890 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 10140853 | RefSeq | NP_065438 | 104 | acyl-CoA-binding protein isoform 1 |
| 120433593 | RefSeq | NP_001073332 | 88 | acyl-CoA-binding protein isoform 2 |
| 120433590 | RefSeq | NP_001073331 | 87 | acyl-CoA-binding protein isoform 3 |
| 295849266 | RefSeq | NP_001171488 | 148 | acyl-CoA-binding protein isoform 4 |
| 295842514 | RefSeq | NP_001171512 | 129 | acyl-CoA-binding protein isoform 5 |
| 295842534 | RefSeq | NP_001171514 | 97 | acyl-CoA-binding protein isoform 6 |
| 544063486 | RefSeq | NP_001269565 | 63 | acyl-CoA-binding protein isoform 7 |
Identical Sequences to LMP001890 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:120433593 | EMBL | CAJ00736.1 | 88 | diazepam binding inhibitor, splice form 1c [Homo sapiens] |
| GI:295842534 | EMBL | CAR82404.1 | 97 | diazepam binding inhibitor, splice form 1A(2) [Homo sapiens] |
| GI:295849266 | EMBL | CAR82409.1 | 148 | diazepam binding inhibitor, splice form 1G [Homo sapiens] |
| GI:295842514 | EMBL | CAR82410.1 | 129 | diazepam binding inhibitor, splice form 1A(1)-G [Homo sapiens] |
| GI:544063486 | EMBL | CAR82411.1 | 63 | diazepam binding inhibitor, splice form 1D(1) [Homo sapiens] |
| GI:120433590 | GenBank | JAA18998.1 | 87 | diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Pan troglodytes] |
| GI:120433590 | GenBank | JAA26532.1 | 87 | diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Pan troglodytes] |
| GI:120433590 | GenBank | JAA33909.1 | 87 | diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Pan troglodytes] |
| GI:10140853 | GenBank | AIC48621.1 | 104 | DBI, partial [synthetic construct] |
| GI:120433590 | RefSeq | XP_004031723.1 | 87 | PREDICTED: acyl-CoA-binding protein isoform 1 [Gorilla gorilla gorilla] |
| GI:120433590 | RefSeq | XP_004031724.1 | 87 | PREDICTED: acyl-CoA-binding protein isoform 2 [Gorilla gorilla gorilla] |
| GI:120433590 | RefSeq | XP_004031725.1 | 87 | PREDICTED: acyl-CoA-binding protein isoform 3 [Gorilla gorilla gorilla] |
| GI:10140853 | RefSeq | XP_004031727.1 | 104 | PREDICTED: acyl-CoA-binding protein isoform 5 [Gorilla gorilla gorilla] |
| GI:10140853 | RefSeq | XP_004031728.1 | 104 | PREDICTED: acyl-CoA-binding protein isoform 6 [Gorilla gorilla gorilla] |
| GI:120433593 | RefSeq | XP_004031729.1 | 88 | PREDICTED: acyl-CoA-binding protein isoform 7 [Gorilla gorilla gorilla] |
| GI:295842534 | RefSeq | XP_004031731.1 | 97 | PREDICTED: acyl-CoA-binding protein isoform 9 [Gorilla gorilla gorilla] |
| GI:10140853 | RefSeq | NP_001269562.1 | 104 | acyl-CoA-binding protein isoform 1 [Homo sapiens] |
| GI:10140853 | RefSeq | NP_001269564.1 | 104 | acyl-CoA-binding protein isoform 1 [Homo sapiens] |
| GI:10140853 | RefSeq | NP_001269563.1 | 104 | acyl-CoA-binding protein isoform 1 [Homo sapiens] |
Related Sequences to LMP001890 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:120433593 | EMBL | CAR82404.1 | 97 | diazepam binding inhibitor, splice form 1A(2) [Homo sapiens] |
| GI:295842514 | EMBL | CAR82409.1 | 148 | diazepam binding inhibitor, splice form 1G [Homo sapiens] |
| GI:295842534 | EMBL | CAR82412.2 | 144 | diazepam binding inhibitor, splice form 1D(2) [Homo sapiens] |
| GI:544063486 | GenBank | AAA35788.1 | 87 | endozepine precursor [Homo sapiens] |
| GI:10140853 | GenBank | AAZ82205.1 | 104 | diazepam-binding protein, partial [Pan troglodytes] |
| GI:10140853 | GenBank | AAZ82206.1 | 104 | diazepam-binding protein, partial [Pan paniscus] |
| GI:10140853 | GenBank | AAZ82208.1 | 104 | diazepam-binding protein, partial [Pongo pygmaeus] |
| GI:10140853 | GenBank | AAZ82209.1 | 104 | diazepam-binding protein, partial [Symphalangus syndactylus] |
| GI:10140853 | GenBank | ACM86039.1 | 107 | Sequence 11537 from patent US 6812339 |
| GI:120433590 | GenBank | AIC48621.1 | 104 | DBI, partial [synthetic construct] |
| GI:544063486 | pat | US | 86 | Sequence 4 from patent US 5734038 |
| GI:120433590 | pat | US | 86 | Sequence 4 from patent US 5734038 |
| GI:295842534 | pat | US | 86 | Sequence 4 from patent US 5734038 |
| GI:120433593 | pat | US | 86 | Sequence 4 from patent US 5734038 |
| GI:295842534 | PDB | 2CB8 | 87 | Chain B, High Resolution Crystal Structure Of Liganded Human L-Acbp |
| GI:544063486 | PDB | 2CB8 | 87 | Chain B, High Resolution Crystal Structure Of Liganded Human L-Acbp |
| GI:544063486 | PDB | 2FJ9 | 86 | Chain A, High Resolution Crystal Structure Of The Unliganded Human Acbp |
| GI:120433590 | PDB | 2FJ9 | 86 | Chain A, High Resolution Crystal Structure Of The Unliganded Human Acbp |
| GI:295842534 | PDB | 2FJ9 | 86 | Chain A, High Resolution Crystal Structure Of The Unliganded Human Acbp |
| GI:544063486 | RefSeq | NP_001073331.1 | 87 | acyl-CoA-binding protein isoform 3 [Homo sapiens] |
| GI:295849266 | RefSeq | NP_001171512.1 | 129 | acyl-CoA-binding protein isoform 5 [Homo sapiens] |
| GI:120433593 | RefSeq | NP_001171514.1 | 97 | acyl-CoA-binding protein isoform 6 [Homo sapiens] |
| GI:295842514 | RefSeq | NP_001171488.1 | 148 | acyl-CoA-binding protein isoform 4 [Homo sapiens] |
| GI:295842534 | RefSeq | XP_002799453.1 | 97 | PREDICTED: acyl-CoA-binding protein-like isoform 2 [Macaca mulatta] |
| GI:295849266 | RefSeq | XP_002812460.1 | 148 | PREDICTED: acyl-CoA-binding protein isoform X1 [Pongo abelii] |
| GI:295842514 | RefSeq | XP_002812460.1 | 148 | PREDICTED: acyl-CoA-binding protein isoform X1 [Pongo abelii] |
| GI:120433590 | RefSeq | XP_004031726.1 | 104 | PREDICTED: acyl-CoA-binding protein isoform 4 [Gorilla gorilla gorilla] |
| GI:120433590 | RefSeq | XP_004031727.1 | 104 | PREDICTED: acyl-CoA-binding protein isoform 5 [Gorilla gorilla gorilla] |
| GI:120433590 | RefSeq | XP_004031728.1 | 104 | PREDICTED: acyl-CoA-binding protein isoform 6 [Gorilla gorilla gorilla] |
| GI:295842514 | RefSeq | XP_004031730.1 | 129 | PREDICTED: acyl-CoA-binding protein isoform 8 [Gorilla gorilla gorilla] |
| GI:120433593 | RefSeq | XP_004031731.1 | 97 | PREDICTED: acyl-CoA-binding protein isoform 9 [Gorilla gorilla gorilla] |
| GI:120433593 | RefSeq | XP_004091662.1 | 88 | PREDICTED: acyl-CoA-binding protein isoform 7 [Nomascus leucogenys] |
| GI:295842534 | RefSeq | XP_004091663.1 | 97 | PREDICTED: acyl-CoA-binding protein isoform 8 [Nomascus leucogenys] |
| GI:295849266 | RefSeq | XP_005596078.1 | 148 | PREDICTED: LOW QUALITY PROTEIN: diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Macaca fascicularis] |
| GI:295849266 | RefSeq | XP_007962924.1 | 148 | PREDICTED: acyl-CoA-binding protein isoform X3 [Chlorocebus sabaeus] |
| GI:10140853 | RefSeq | XP_009235925.1 | 104 | PREDICTED: acyl-CoA-binding protein isoform X2 [Pongo abelii] |
| GI:120433593 | RefSeq | XP_009235926.1 | 88 | PREDICTED: acyl-CoA-binding protein isoform X3 [Pongo abelii] |
| GI:295849266 | RefSeq | XP_009441456.1 | 148 | PREDICTED: acyl-CoA-binding protein isoform X2 [Pan troglodytes] |
| GI:295842514 | RefSeq | XP_009441456.1 | 148 | PREDICTED: acyl-CoA-binding protein isoform X2 [Pan troglodytes] |
| GI:295849266 | RefSeq | XP_010360455.1 | 148 | PREDICTED: acyl-CoA-binding protein isoform X2 [Rhinopithecus roxellana] |
| GI:295842514 | RefSeq | XP_010360455.1 | 148 | PREDICTED: acyl-CoA-binding protein isoform X2 [Rhinopithecus roxellana] |
| GI:544063486 | SwissProt | P07108.2 | 87 | RecName: Full=Acyl-CoA-binding protein; Short=ACBP; AltName: Full=Diazepam-binding inhibitor; Short=DBI; AltName: Full=Endozepine; Short=EP [Homo sapiens] |