Gene/Proteome Database (LMPD)
LMPD ID
LMP001878
Gene ID
Species
Homo sapiens (Human)
Gene Name
glutathione peroxidase 4
Gene Symbol
Synonyms
GPx-4; GSHPx-4; MCSP; PHGPx; snGPx; snPHGPx
Alternate Names
phospholipid hydroperoxide glutathione peroxidase, mitochondrial; phospholipid hydroperoxidase; sperm nucleus glutathione peroxidase
Chromosome
19
Map Location
19p13.3
EC Number
1.11.1.12
Summary
This gene encodes a member of the glutathione peroxidase protein family. Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. The encoded protein has been identified as a moonlighting protein based on its ability to serve dual functions as a peroxidase as well as a structural protein in mature spermatozoa. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Orthologs
Proteins
| phospholipid hydroperoxide glutathione peroxidase, mitochondrial isoform A precursor | |
|---|---|
| Refseq ID | NP_002076 |
| Protein GI | 75709200 |
| UniProt ID | P36969 |
| mRNA ID | NM_002085 |
| Length | 197 |
| RefSeq Status | REVIEWED |
| MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF | |
| sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2509 peptide sequence: MSLGRLCRLLKPALLCGALAAPGLA sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2509 peptide sequence: MSLGRLCRLLKPALLCGALAAPGLA | |
| phospholipid hydroperoxide glutathione peroxidase, mitochondrial isoform B precursor | |
|---|---|
| Refseq ID | NP_001034936 |
| Protein GI | 90903238 |
| UniProt ID | P36969 |
| mRNA ID | NM_001039847 |
| Length | 227 |
| RefSeq Status | REVIEWED |
| MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFGHRLSTVPHRQERLRGEALRTHGGAPGDREGPAPLFLAPQVCGPARAPAHALGAFHRHS | |
| phospholipid hydroperoxide glutathione peroxidase, mitochondrial isoform C precursor | |
|---|---|
| Refseq ID | NP_001034937 |
| Protein GI | 90903240 |
| UniProt ID | Q6PI42 |
| mRNA ID | NM_001039848 |
| Length | 234 |
| RefSeq Status | REVIEWED |
| MGRAGAGSPGRRRQRCQSRGRRRPRAPRRRKAPACRRRRARRRRKKPCPRSLRPEIHECPKSQDPCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0005743 | IEA:Ensembl | C | mitochondrial inner membrane |
| GO:0005739 | TAS:UniProtKB | C | mitochondrion |
| GO:0005635 | IEA:Ensembl | C | nuclear envelope |
| GO:0005634 | IDA:UniProt | C | nucleus |
| GO:0043295 | IEA:Ensembl | F | glutathione binding |
| GO:0004602 | TAS:UniProtKB | F | glutathione peroxidase activity |
| GO:0047066 | IEA:UniProtKB-EC | F | phospholipid-hydroperoxide glutathione peroxidase activity |
| GO:0008430 | IEA:Ensembl | F | selenium binding |
| GO:0007568 | IEA:Ensembl | P | aging |
| GO:0019369 | TAS:Reactome | P | arachidonic acid metabolic process |
| GO:0006325 | IEA:Ensembl | P | chromatin organization |
| GO:0006749 | IEA:Ensembl | P | glutathione metabolic process |
| GO:0042744 | IEA:Ensembl | P | hydrogen peroxide catabolic process |
| GO:0019372 | TAS:Reactome | P | lipoxygenase pathway |
| GO:0007275 | IEA:UniProtKB-KW | P | multicellular organismal development |
| GO:0055114 | TAS:UniProtKB | P | oxidation-reduction process |
| GO:0006644 | TAS:UniProtKB | P | phospholipid metabolic process |
| GO:0050727 | IEA:Ensembl | P | regulation of inflammatory response |
| GO:0032355 | IEA:Ensembl | P | response to estradiol |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0007283 | IEA:Ensembl | P | spermatogenesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_150201 | Synthesis of 12-eicosatetraenoic acid derivatives |
| REACT_150422 | Synthesis of 15-eicosatetraenoic acid derivatives |
| REACT_150209 | Synthesis of 5-eicosatetraenoic acids |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative initiation; Named isoforms=2; Name=Mitochondrial; IsoId=P36969-1; Sequence=Displayed; Name=Cytoplasmic; IsoId=P36969-2; Sequence=VSP_018740; |
| Catalytic Activity | 2 glutathione + a lipid hydroperoxide = glutathione disulfide + lipid + 2 H(2)O. |
| Disease | Spondylometaphyseal dysplasia, Sedaghatian type (SMDS) [MIM |
| Function | Protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility. Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage (By similarity). |
| Similarity | Belongs to the glutathione peroxidase family. |
| Subcellular Location | Isoform Cytoplasmic: Cytoplasm. |
| Subcellular Location | Isoform Mitochondrial: Mitochondrion. |
| Subunit | Monomer. Has a tendency to form higher mass oligomers. |
| Tissue Specificity | Present primarily in testis. |
| Web Resource | Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/gpx4/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP001878 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 75709200 | RefSeq | NP_002076 | 197 | phospholipid hydroperoxide glutathione peroxidase, mitochondrial isoform A precursor |
| 90903238 | RefSeq | NP_001034936 | 227 | phospholipid hydroperoxide glutathione peroxidase, mitochondrial isoform B precursor |
| 90903240 | RefSeq | NP_001034937 | 234 | phospholipid hydroperoxide glutathione peroxidase, mitochondrial isoform C precursor |
Identical Sequences to LMP001878 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:75709200 | DBBJ | BAE17018.1 | 197 | glutathione peroxidase 4 [Pongo pygmaeus] |
| GI:75709200 | GenBank | AAC03239.1 | 197 | GSHH_HUMAN [Homo sapiens] |
| GI:75709200 | GenBank | AAC32261.1 | 197 | selenium-dependent phospholipid hydroperoxide glutathione peroxidase [Homo sapiens] |
| GI:75709200 | GenBank | AAP72965.1 | 197 | glutathione peroxidase 4 (phospholipid hydroperoxidase) [Homo sapiens] |
| GI:75709200 | SwissProt | P36969.3 | 197 | RecName: Full=Phospholipid hydroperoxide glutathione peroxidase, mitochondrial; Short=PHGPx; AltName: Full=Glutathione peroxidase 4; Short=GPx-4; Short=GSHPx-4; Flags: Precursor [Homo sapiens] |
| GI:75709200 | SwissProt | Q4AEH2.2 | 197 | RecName: Full=Phospholipid hydroperoxide glutathione peroxidase, mitochondrial; Short=PHGPx; AltName: Full=Glutathione peroxidase 4; Short=GPx-4; Short=GSHPx-4; Flags: Precursor [Pongo pygmaeus] |
Related Sequences to LMP001878 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:90903240 | DBBJ | BAC06509.1 | 253 | nuclear phospholipid hydroperoxide glutathione peroxidase [Mus musculus] |
| GI:75709200 | EMBL | CAA50793.1 | 197 | phospholipid hydroperoxide glutathione peroxidase [Homo sapiens] |
| GI:90903238 | EMBL | CAA50793.1 | 197 | phospholipid hydroperoxide glutathione peroxidase [Homo sapiens] |
| GI:90903238 | GenBank | AAH11836.1 | 197 | Glutathione peroxidase 4 (phospholipid hydroperoxidase) [Homo sapiens] |
| GI:75709200 | GenBank | AAH11836.1 | 197 | Glutathione peroxidase 4 (phospholipid hydroperoxidase) [Homo sapiens] |
| GI:75709200 | GenBank | AAH39849.1 | 197 | Glutathione peroxidase 4 (phospholipid hydroperoxidase) [Homo sapiens] |
| GI:90903238 | GenBank | AAH39849.1 | 197 | Glutathione peroxidase 4 (phospholipid hydroperoxidase) [Homo sapiens] |
| GI:75709200 | GenBank | AAH21567.1 | 197 | Glutathione peroxidase 4 (phospholipid hydroperoxidase) [Homo sapiens] |
| GI:90903238 | GenBank | ACM80670.1 | 197 | Sequence 6168 from patent US 6812339 |
| GI:75709200 | GenBank | ACM80670.1 | 197 | Sequence 6168 from patent US 6812339 |
| GI:75709200 | GenBank | AHD72833.1 | 197 | Sequence 9901 from patent US 8586006 |
| GI:90903238 | GenBank | AHD72833.1 | 197 | Sequence 9901 from patent US 8586006 |
| GI:90903240 | RefSeq | XP_006050558.1 | 240 | PREDICTED: LOW QUALITY PROTEIN: phospholipid hydroperoxide glutathione peroxidase, nuclear [Bubalus bubalis] |
| GI:90903240 | RefSeq | XP_007992765.1 | 381 | PREDICTED: LOW QUALITY PROTEIN: phospholipid hydroperoxide glutathione peroxidase, mitochondrial [Chlorocebus sabaeus] |
| GI:90903240 | RefSeq | XP_008586242.1 | 320 | PREDICTED: LOW QUALITY PROTEIN: phospholipid hydroperoxide glutathione peroxidase, mitochondrial-like [Galeopterus variegatus] |
| GI:90903238 | RefSeq | XP_008964608.1 | 227 | PREDICTED: LOW QUALITY PROTEIN: phospholipid hydroperoxide glutathione peroxidase, mitochondrial [Pan paniscus] |
| GI:90903240 | RefSeq | XP_008985133.1 | 234 | PREDICTED: LOW QUALITY PROTEIN: phospholipid hydroperoxide glutathione peroxidase, mitochondrial [Callithrix jacchus] |
| GI:90903240 | RefSeq | XP_009191277.1 | 234 | PREDICTED: LOW QUALITY PROTEIN: phospholipid hydroperoxide glutathione peroxidase, mitochondrial [Papio anubis] |